KEGG   Chlamydia trachomatis E/11023: E11023_02645Help
Entry
E11023_02645      CDS       T01902                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
ctg  Chlamydia trachomatis E/11023
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ctg00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    E11023_02645 (ruvA)
Enzymes [BR:ctg01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     E11023_02645 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(580569..581171)
Genome map
AA seq 200 aa AA seqDB search
MYEYIKGTLTHIDESYVVIESFGIGYAIMLSERFLVDLRAFMHQEVLIYVHSVIRETEHV
LYGFSSRDERECFRLLISFSGIGPKTGLSILNMFPLQELCSIARLENVKAIASVPGIGKK
TAEKLMVDLKQKLPTLMPLYLEEPVVPSSTANSSFKEGIGALMNLGFSRLAADRMMTEAV
KELSEEASVAELLPIALRKS
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgtacgagtatattaaaggcactttgactcatattgatgagtcttatgttgtgattgaa
agcttcggcataggatatgctattatgctttctgagcgttttttagtagatttgcgcgca
tttatgcatcaagaggtgctgatttatgttcatagcgtcattcgtgaaactgagcacgtt
ctatacggttttagctctcgcgatgaaagggagtgttttcgtttattaatttctttttct
ggtattggccctaaaacaggactatctattttaaatatgttccctttgcaagagttgtgt
tctattgcgcgcttagaaaatgtgaaagctattgcgtctgttcctgggatagggaaaaaa
acagcagaaaagctgatggtggatcttaaacaaaaacttcctactttgatgcccctttac
ttagaggaacccgtagttccttcctcgacagcgaattcttctttcaaagaaggaatcgga
gctctaatgaatcttgggttctctcgtcttgcagcagatcgtatgatgaccgaggctgta
aaagaattatctgaagaagcttcagtagccgaactgcttcctatagcattaagaaaaagc
tag

DBGET integrated database retrieval system