KEGG   Chlamydia trachomatis E/11023: E11023_03340Help
Entry
E11023_03340      CDS       T01902                                 

Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
ctg  Chlamydia trachomatis E/11023
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ctg00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    E11023_03340
Enzymes [BR:ctg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     E11023_03340
Exosome [BR:ctg04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   E11023_03340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
720719..721735
Genome map
AA seq 338 aa AA seqDB search
MTRLPLLKRPRRNRKSAAVRSIIQETQLCSSDLIWPIFLKDGSGIREEIESMPGVYRWSL
DMVSKELERLCTIGLKAVILFPVIDANKKEQFGSYASHPYNIVCKGIQAIKKSFPELCVI
SDIALDPFTTSGHDGIFHNNYVINDESVRVYGGIAVMHAEMGADIVAPSDMMDGRVKHIR
EQMDQMGFVNTGILSYSAKYASALYGPFRDALSSHLQSGDKRTYQMDPANVQEALLECQL
DEEEGADMVMIKPAGFYLDVIVKARENTHLPVVAYQVSGEFSMIMAACLHGWLNKESVIK
ESLLAIKRAGATAIISYATPWVLEWLAKDALPFERSVL
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgacaaggcttccattactaaaacgacctcgcagaaaccgaaaaagtgcagccgttcga
tctataattcaagaaacccaactctgttctagtgacttgatctggcccatctttcttaaa
gatggctctggaattcgagaagaaatagagagtatgcctggagtatacagatggagttta
gacatggtctctaaagagttagagagactttgtacgataggattgaaagcagttatcctc
tttcctgtaattgatgctaataaaaaagaacaatttggatcctatgcgtcccatccttac
aacattgtttgtaaagggattcaagcgataaaaaaatcttttccagaattatgtgtcatc
agtgacatagctttagatccttttacaaccagtggtcacgatgggatttttcataataac
tacgttatcaatgatgaaagtgtccgtgtatatgggggtatcgctgtcatgcatgcggaa
atgggagcagatattgttgctcctagcgatatgatggatgggagagtgaagcatattcga
gagcagatggatcagatggggtttgtcaacacgggtattctctcgtacagtgcaaaatat
gcatctgcattgtatggcccatttcgggatgctctttcttcacatcttcagtctggagat
aagcgtacatatcaaatggatcctgccaatgttcaagaagcgttgctagagtgtcagtta
gatgaagaagaaggcgctgatatggtgatgataaaacccgcaggtttttatctagatgta
atcgttaaagcgagagaaaacacccatcttccggtggtagcctatcaagtcagcggggaa
ttttctatgattatggctgcttgccttcatgggtggttaaacaaagaaagtgtaataaaa
gaatctttattagcgattaagagagctggtgcaacagctataattagttacgcaacacca
tgggttttagaatggctagctaaagatgctcttccctttgagagaagtgttctttga

DBGET integrated database retrieval system