KEGG   Chlamydia trachomatis E/11023: E11023_03810Help
Entry
E11023_03810      CDS       T01902                                 

Definition
phosphoglyceromutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ctg  Chlamydia trachomatis E/11023
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ctg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    E11023_03810
   01230 Biosynthesis of amino acids
    E11023_03810
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    E11023_03810
  Energy metabolism
   00680 Methane metabolism
    E11023_03810
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    E11023_03810
Enzymes [BR:ctg01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     E11023_03810
Exosome [BR:ctg04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   E11023_03810
  Exosomal proteins of melanoma cells
   E11023_03810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(834371..835051)
Genome map
AA seq 226 aa AA seqDB search
MTLLILLRHGQSAWNQKNLFTGWVDIPLSQQGIQEAIAAGESIKHLPIDCIFTSTLVRSL
MTALLAMTNHSSQKVPYIVHEERPDMSRIHSQKEMEQMIPLFQSSALNERMYGELQGKNK
QEVAAQFGEEQVKLWRRSYRIAPPQGESLFDTGQRTLPYFQERIFPLLQQGKNIFISAHG
NSLRSLIMDLEKLSEEQVLSLELPTGQPIVYEWTGQKFTKHAPSLG
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgacgcttcttatcttgctacgccatggccaatccgcatggaatcaaaaaaatctgttt
acaggctgggtagacatccctcttagccaacaaggaattcaagaggctattgccgctgga
gaatctattaaacatcttcctattgattgcatcttcacttccaccttggttagaagtttg
atgacagccctgttagcaatgactaaccacagctctcaaaaagttccttatatcgttcat
gaagagcgccccgacatgagccggattcatagtcaaaaagaaatggagcagatgatccct
ctttttcaatctagcgctctcaatgaacgcatgtacggagaacttcaaggaaaaaataaa
caagaagtcgctgctcaattcggagaagaacaggtaaaactgtggcgccgaagctaccgc
attgcccctcctcagggcgaaagtcttttcgatacagggcaacgaaccctcccctatttt
caagagagaattttccctctccttcagcaagggaaaaatatttttatctctgctcacggg
aattctttgcgctccttaattatggacctagaaaaattatctgaagaacaagtactctct
ttggagttgccaacaggacagcctattgtatacgaatggacgggacaaaaattcacgaaa
cacgctccttctcttggttaa

DBGET integrated database retrieval system