KEGG   Ruminiclostridium thermocellum ATCC 27405: Cthe_0139Help
Entry
Cthe_0139         CDS       T00474                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cth  Ruminiclostridium thermocellum ATCC 27405
Pathway
cth00010  Glycolysis / Gluconeogenesis
cth00051  Fructose and mannose metabolism
cth00562  Inositol phosphate metabolism
cth01100  Metabolic pathways
cth01110  Biosynthesis of secondary metabolites
cth01120  Microbial metabolism in diverse environments
cth01130  Biosynthesis of antibiotics
cth01200  Carbon metabolism
cth01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cth00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cthe_0139
   00051 Fructose and mannose metabolism
    Cthe_0139
   00562 Inositol phosphate metabolism
    Cthe_0139
Enzymes [BR:cth01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Cthe_0139
Exosome [BR:cth04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Cthe_0139
  Exosomal proteins of bladder cancer cells
   Cthe_0139
  Exosomal proteins of melanoma cells
   Cthe_0139
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ABN51380
JGI: Cthe_0139
UniProt: A3DBQ1
Position
176441..177196
Genome map
AA seq 251 aa AA seqDB search
MSRKVIAAGNWKMNKTPKEAVEFVQALKGRVADADTEVVVGVPFVCLPGVVEAAKGSNIK
VAAQNMHWEEKGAFTGEVSGPMLAELGVDYVIIGHSERRQYFGETDETVNKKVHAAFKYG
LKPIICVGESLTQREQGVTAELVRYQVKIALLGLSAEQVKEAVIAYEPIWAIGTGKTATN
EQAEEVCGIIRECIKELYGQDVAEAIRIQYGGSVNAANAAELFNMPNIDGGLVGGASLKL
DDFEKIAKYNK
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgagtagaaaagttattgcagccggaaactggaaaatgaacaaaacaccgaaggaagcc
gttgagttcgtacaggctttaaaaggaagagtggcagatgccgataccgaagtagtggta
ggtgtgccctttgtatgtttgcctggagttgttgaggcggcaaaaggatcaaatatcaag
gttgccgcacaaaacatgcactgggaggaaaaaggtgcttttaccggagaagtatccgga
cctatgctggccgaacttggtgttgactatgttatcataggtcactccgaaagaagacaa
tacttcggtgaaacagatgaaactgttaataaaaaggtacatgcggcattcaaatatggc
ttaaagccgattatctgcgttggtgagtccctcactcaaagagaacagggggttaccgcc
gaactggtaagataccaggttaagattgctttgctgggactttccgccgaacaggtgaaa
gaggctgtaatagcctatgaacctatctgggccattggtacaggaaagactgctacaaat
gagcaggcagaagaagtttgcggcataataagagaatgcataaaagagctttacggtcag
gatgttgccgaagctatcagaattcagtacggcggaagtgttaatgctgccaatgcggca
gaactcttcaatatgccgaacatcgacggaggccttgtgggaggcgcaagcttaaagctt
gatgactttgagaaaatcgcaaagtacaacaagtaa

DBGET integrated database retrieval system