KEGG   Ruminiclostridium thermocellum ATCC 27405: Cthe_0139Help
Entry
Cthe_0139         CDS       T00474                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cth  Ruminiclostridium thermocellum ATCC 27405
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cth00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Cthe_0139 (tpiA)
   01230 Biosynthesis of amino acids
    Cthe_0139 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cthe_0139 (tpiA)
   00051 Fructose and mannose metabolism
    Cthe_0139 (tpiA)
   00562 Inositol phosphate metabolism
    Cthe_0139 (tpiA)
Enzymes [BR:cth01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Cthe_0139 (tpiA)
Exosome [BR:cth04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Cthe_0139 (tpiA)
  Exosomal proteins of bladder cancer cells
   Cthe_0139 (tpiA)
  Exosomal proteins of melanoma cells
   Cthe_0139 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
176441..177196
Genome map
AA seq 251 aa AA seqDB search
MSRKVIAAGNWKMNKTPKEAVEFVQALKGRVADADTEVVVGVPFVCLPGVVEAAKGSNIK
VAAQNMHWEEKGAFTGEVSGPMLAELGVDYVIIGHSERRQYFGETDETVNKKVHAAFKYG
LKPIICVGESLTQREQGVTAELVRYQVKIALLGLSAEQVKEAVIAYEPIWAIGTGKTATN
EQAEEVCGIIRECIKELYGQDVAEAIRIQYGGSVNAANAAELFNMPNIDGGLVGGASLKL
DDFEKIAKYNK
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgagtagaaaagttattgcagccggaaactggaaaatgaacaaaacaccgaaggaagcc
gttgagttcgtacaggctttaaaaggaagagtggcagatgccgataccgaagtagtggta
ggtgtgccctttgtatgtttgcctggagttgttgaggcggcaaaaggatcaaatatcaag
gttgccgcacaaaacatgcactgggaggaaaaaggtgcttttaccggagaagtatccgga
cctatgctggccgaacttggtgttgactatgttatcataggtcactccgaaagaagacaa
tacttcggtgaaacagatgaaactgttaataaaaaggtacatgcggcattcaaatatggc
ttaaagccgattatctgcgttggtgagtccctcactcaaagagaacagggggttaccgcc
gaactggtaagataccaggttaagattgctttgctgggactttccgccgaacaggtgaaa
gaggctgtaatagcctatgaacctatctgggccattggtacaggaaagactgctacaaat
gagcaggcagaagaagtttgcggcataataagagaatgcataaaagagctttacggtcag
gatgttgccgaagctatcagaattcagtacggcggaagtgttaatgctgccaatgcggca
gaactcttcaatatgccgaacatcgacggaggccttgtgggaggcgcaagcttaaagctt
gatgactttgagaaaatcgcaaagtacaacaagtaa

DBGET integrated database retrieval system