KEGG   Ruminiclostridium thermocellum ATCC 27405: Cthe_0181Help
Entry
Cthe_0181         CDS       T00474                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
cth  Ruminiclostridium thermocellum ATCC 27405
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:cth00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Cthe_0181 (ruvA)
Enzymes [BR:cth01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Cthe_0181 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
217532..218140
Genome map
AA seq 202 aa AA seqDB search
MFAYIRGRLEYKNNDFLIVESNGVGYRIFTSLSTISGIGEIGQEVKVYTYLYVREDVISL
YGFLTQEELNVFELLISVSGVGPKAAVSVLSAISPSRFSLAVITDDVKTLTKAQGIGKKI
AQRIILELKDKIKKEQLTEYAQSEEGGKVLDTDSSKMAEAVSALMVLGYSPAEANKAVSA
VYREDMDIETIIKNALKGLARP
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
ttgtttgcatatatcagaggaagacttgaatacaaaaacaatgattttttgattgttgaa
tcaaacggagtgggatacaggatttttacgtccctttccaccatttcgggcattggcgag
ataggacaggaagtaaaggtctacacatatctttatgttcgggaagacgttataagcttg
tatggatttttaactcaggaagagctcaatgtgtttgaactcttaatcagtgtttccggt
gtgggaccgaaggcggcggtatcggttttgtcggcaatatcgccctccaggttcagcctt
gcggttataaccgatgatgtaaagacattgacaaaagctcagggtataggaaagaaaatt
gcccaaaggataatacttgaacttaaggacaagataaagaaagaacagctgacagaatat
gcccaaagtgaagaaggcggcaaagttttggacacggacagttcaaaaatggcggaggcg
gtaagcgcccttatggttttgggatattctccggctgaagcaaataaagcggtatcggcg
gtttacagggaggatatggacatcgaaacgataattaaaaatgctcttaaaggactggca
agaccttaa

DBGET integrated database retrieval system