KEGG   Clostridium thermocellum ATCC 27405: Cthe_0319Help
Entry
Cthe_0319         CDS       T00474                                 

Definition
class II aldolase/adducin-like protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
cth  Clostridium thermocellum ATCC 27405
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:cth00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
402462..403106
Genome map
AA seq 214 aa AA seqDB search
MSDAIREQIVKVAKLMYEKGMVNAFAGNLSVRDGNNVYITPSGICKGFLKEDMIVKTDMN
GNILEGMYKPSSEIKLHLEAYKKRKDIYSVVHAHPPYTTAYAVANKPIESKACAEMVIFF
GKIPLAAYGTPSTDEIFSGVEEYINEYDVILLANHGIVSFGRDVFDAYFKLEAAEDIAKT
LILSRLLGGEKDLPENKLKELDDMRKKRRTEVYW
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgtcggatgctattagagaacaaatagtgaaagtagcaaagttaatgtatgagaaaggt
atggtaaacgcttttgccggaaacctttccgttcgggacggcaacaatgtttacattaca
cccagcggtatatgcaaaggttttttaaaggaagacatgattgtgaaaaccgatatgaac
ggaaatatactggaagggatgtacaagccttcgtctgaaataaaacttcatctcgaggca
tacaagaaaaggaaggatatatattccgtggtgcatgcccatcctccttataccactgcg
tacgcggttgccaacaaacctattgaatcaaaagcgtgtgctgaaatggttatttttttt
ggaaagatacctcttgcagcatacggtaccccgtcgacagatgaaatatttagcggtgtc
gaagaatatattaatgagtacgatgttatccttcttgccaatcacggaatagtgtctttt
ggaagagatgtctttgatgcctactttaagcttgaagcggctgaggatatagctaaaact
ttgattttatcgcgccttctcgggggagagaaagacttgccggagaacaaactaaaggag
cttgatgacatgagaaaaaaacgtagaacggaagtttactggtaa

DBGET integrated database retrieval system