KEGG   Clostridium thermocellum ATCC 27405: Cthe_0322Help
Entry
Cthe_0322         CDS       T00474                                 

Definition
glycoside hydrolase family protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
cth  Clostridium thermocellum ATCC 27405
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cth00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Cthe_0322
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    Cthe_0322
Enzymes [BR:cth01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Cthe_0322
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(405713..407047)
Genome map
AA seq 444 aa AA seqDB search
MKKRVHILIMTLMLIVACVGCSGSSDNPPPANSLHSASTIPISAMPSFSTPSPTVEDTEN
QQSKTVNYLINSMTLEEKIGQIFIVAFRKGKSSRPLKVLDNSTKLKIQNFNPGGIILFSE
NIDTIPQTQKLIRDMQEASKIPMFIAVDEEGGRIARIGNNPKMHSTKIPSAQTIGLADDP
ELAYEAGRILGAELSALGFNMNFAPVADVNTNPDNPVIGDRSFGSDPYKVGLMVQAMSKG
MQEQNVCTVLKHFPGHGDTSYDSHLGQVVINHDIERLRQIELTPFKMGIKAGADGVMTAH
IIMPNITGSNLPATLSEEILSGLLRNELKHEKLIITDAMEMKAISNYWSSSKAAVMAFKA
GADIILMPESFEEAYNGILKAVKDGEITEERLNQSLQRILALKFERNILANKESSVDPEK
VLGRQEHTDIVVKIMQKAEEQNIP
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaagagttcatattctaataatgaccttaatgctaattgtggcttgtgtcgga
tgcagcggcagttccgataatccgccgcctgccaacagtttgcattcggcatcaaccata
ccgatatcagctatgccttctttttcgactccttcacctactgttgaagatactgaaaat
caacaatcgaaaacagtgaattacttgataaattccatgaccttggaggaaaagatcgga
cagattttcattgttgcctttagaaaaggcaaatcttcacgcccgttaaaagtattggac
aattctacaaaactgaagattcagaactttaatcccggtggtataatacttttcagcgaa
aacatagacaccataccgcagacacaaaaactcattcgtgatatgcaagaggcaagcaaa
attcccatgttcatcgctgttgacgaagaaggcgggcgaatagcaagaatcggaaacaat
ccgaaaatgcattccacaaaaataccctccgcccagacaataggacttgccgatgacccc
gaacttgcgtatgaggcaggcaggatactgggtgcggagctgtctgcccttggctttaac
atgaatttcgcaccggtggccgatgtaaatacaaatccggacaatcctgttatcggagac
agatcttttggttccgacccctataaagtcggcttaatggtacaggcgatgtccaaaggt
atgcaggagcaaaatgtctgcaccgtgctaaagcactttcccggtcatggcgacacctcc
tacgactcgcatcttggtcaggtggtaataaatcacgacattgaaaggcttcgccaaata
gaactgacaccttttaaaatgggcatcaaggccggcgccgacggcgtaatgacggctcat
atcataatgcccaacattaccggcagcaatctgcccgcaactctgtctgaagaaatcctc
agcgggcttttgagaaatgagttaaaacacgaaaagctcattataaccgatgcaatggaa
atgaaggcaatcagcaactactggtcttcttccaaggctgcggtcatggcatttaaagca
ggagcagacatcatactcatgcccgaatcatttgaagaagcctataacggtattctcaaa
gccgtaaaagatggtgaaataacggaagaaaggctaaatcagtccctgcaaagaattctc
gctctaaaatttgaaagaaacatacttgcaaataaagaaagctccgtcgaccctgaaaaa
gtattgggcagacaagagcatactgacatagtagtgaaaatcatgcaaaaggcagaagag
caaaatatcccttaa

DBGET integrated database retrieval system