KEGG   Clostridium thermocellum ATCC 27405: Cthe_0347Help
Entry
Cthe_0347         CDS       T00474                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cth  Clostridium thermocellum ATCC 27405
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cth00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Cthe_0347
   01230 Biosynthesis of amino acids
    Cthe_0347
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cthe_0347
   00030 Pentose phosphate pathway
    Cthe_0347
   00051 Fructose and mannose metabolism
    Cthe_0347
   00052 Galactose metabolism
    Cthe_0347
  Energy metabolism
   00680 Methane metabolism
    Cthe_0347
Enzymes [BR:cth01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Cthe_0347
Protein phosphatases and associated proteins [BR:cth01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Cthe_0347
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(436020..437267)
Genome map
AA seq 415 aa AA seqDB search
MSRLEGACIFGQSGGPTSVINASAAGVIQEALKQDCITAVYGAAHGIKGILEENFFDMSK
EDPYELELLKTTPSSALGSVRYKLKDADEDETDYKRLLEVFKKYNIRYFFYNGGNDSMDT
CNKVSKYMQKVGYECRVMGVPKTIDNDLWGTDHCPGYGSAAKYIATSIMEVYHDARVYDT
GMITILEIMGRNAGWLTAAAALASYKGNGPDLIYLPELSFDIDKFVEDVTRIYKENGKVI
VAVSEGIKDKNGKYISEYGSDLAKTKDSFGHAQLGGLASTLANIVKEKTGAKVRGIEFSL
LQRCAAHVASLTDVNEAYLAGQAAVQYAVEGKTDYMVAFERAEGPEYKCNIKLLNLSEVA
NTEKKVPLEWIKPDGAGLTEDFIKYALPLIQGESRPPIEDGLPRFAKLKKVLARK
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgagccgtttagaaggtgcatgcatattcggacaatccggcggtccgacatcagttatc
aacgcaagtgcggctggtgttattcaggaagctttaaagcaggattgtatcacagcagtt
tacggagcagctcatggaatcaagggtattttggaagaaaacttctttgacatgagtaag
gaagatccttatgaattggaacttttaaaaactaccccttcatctgctctgggttctgta
agatacaaactcaaagacgcagacgaggatgaaacggattacaagagacttttggaagta
ttcaagaaatacaatatcagatacttcttctacaatggcggaaacgactcaatggacacc
tgcaacaaggtcagcaaatacatgcagaaggttggctatgagtgcagagtaatgggtgtg
ccgaagacaatagacaacgacctttggggaacagaccactgccccggttacggaagtgcc
gcaaaatatatagcaacatccattatggaagtttatcatgatgcaagagtttacgataca
ggaatgataacaattctcgaaatcatgggaagaaacgcaggctggcttaccgctgccgca
gctttggcttcatacaagggcaatggtcctgatttgatataccttcccgagctttccttt
gacatagacaaatttgttgaagatgtgacaagaatctacaaagaaaacggaaaggttatt
gtagccgtatctgaaggtatcaaagacaaaaacggaaaatatatttccgaatacggttca
gaccttgcgaaaacaaaagactcctttggacatgcacagttgggcggtcttgcttcaaca
ctggctaacattgttaaagagaagaccggcgcaaaggttcgcggcattgaattcagcctt
ctccaaagatgcgcagctcacgtagcttctcttaccgacgtaaatgaagcttatcttgca
ggacaggcagccgtacaatatgccgttgaagggaaaacagactacatggttgcttttgaa
agagcggaaggtcctgaatacaagtgcaatatcaagcttctgaacctcagtgaagttgca
aatactgagaagaaagttccgttggaatggattaaacctgacggagcaggccttacagaa
gactttattaagtatgctcttccgttaattcagggagaatcaagacctcctatcgaagat
ggtcttccaagatttgcaaaactgaaaaaggttcttgcaagaaaataa

DBGET integrated database retrieval system