KEGG   Ruminiclostridium thermocellum ATCC 27405: Cthe_0347Help
Entry
Cthe_0347         CDS       T00474                                 

Definition
(GenBank) phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
cth  Ruminiclostridium thermocellum ATCC 27405
Pathway
cth00010  Glycolysis / Gluconeogenesis
cth00030  Pentose phosphate pathway
cth00051  Fructose and mannose metabolism
cth00052  Galactose metabolism
cth00680  Methane metabolism
cth01100  Metabolic pathways
cth01110  Biosynthesis of secondary metabolites
cth01120  Microbial metabolism in diverse environments
cth01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cth00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cthe_0347
   00030 Pentose phosphate pathway
    Cthe_0347
   00051 Fructose and mannose metabolism
    Cthe_0347
   00052 Galactose metabolism
    Cthe_0347
  Energy metabolism
   00680 Methane metabolism
    Cthe_0347
Enzymes [BR:cth01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Cthe_0347
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     Cthe_0347
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-ProteinID: ABN51585
JGI: Cthe_0347
UniProt: A3DCA6
Position
complement(436020..437267)
Genome map
AA seq 415 aa AA seqDB search
MSRLEGACIFGQSGGPTSVINASAAGVIQEALKQDCITAVYGAAHGIKGILEENFFDMSK
EDPYELELLKTTPSSALGSVRYKLKDADEDETDYKRLLEVFKKYNIRYFFYNGGNDSMDT
CNKVSKYMQKVGYECRVMGVPKTIDNDLWGTDHCPGYGSAAKYIATSIMEVYHDARVYDT
GMITILEIMGRNAGWLTAAAALASYKGNGPDLIYLPELSFDIDKFVEDVTRIYKENGKVI
VAVSEGIKDKNGKYISEYGSDLAKTKDSFGHAQLGGLASTLANIVKEKTGAKVRGIEFSL
LQRCAAHVASLTDVNEAYLAGQAAVQYAVEGKTDYMVAFERAEGPEYKCNIKLLNLSEVA
NTEKKVPLEWIKPDGAGLTEDFIKYALPLIQGESRPPIEDGLPRFAKLKKVLARK
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgagccgtttagaaggtgcatgcatattcggacaatccggcggtccgacatcagttatc
aacgcaagtgcggctggtgttattcaggaagctttaaagcaggattgtatcacagcagtt
tacggagcagctcatggaatcaagggtattttggaagaaaacttctttgacatgagtaag
gaagatccttatgaattggaacttttaaaaactaccccttcatctgctctgggttctgta
agatacaaactcaaagacgcagacgaggatgaaacggattacaagagacttttggaagta
ttcaagaaatacaatatcagatacttcttctacaatggcggaaacgactcaatggacacc
tgcaacaaggtcagcaaatacatgcagaaggttggctatgagtgcagagtaatgggtgtg
ccgaagacaatagacaacgacctttggggaacagaccactgccccggttacggaagtgcc
gcaaaatatatagcaacatccattatggaagtttatcatgatgcaagagtttacgataca
ggaatgataacaattctcgaaatcatgggaagaaacgcaggctggcttaccgctgccgca
gctttggcttcatacaagggcaatggtcctgatttgatataccttcccgagctttccttt
gacatagacaaatttgttgaagatgtgacaagaatctacaaagaaaacggaaaggttatt
gtagccgtatctgaaggtatcaaagacaaaaacggaaaatatatttccgaatacggttca
gaccttgcgaaaacaaaagactcctttggacatgcacagttgggcggtcttgcttcaaca
ctggctaacattgttaaagagaagaccggcgcaaaggttcgcggcattgaattcagcctt
ctccaaagatgcgcagctcacgtagcttctcttaccgacgtaaatgaagcttatcttgca
ggacaggcagccgtacaatatgccgttgaagggaaaacagactacatggttgcttttgaa
agagcggaaggtcctgaatacaagtgcaatatcaagcttctgaacctcagtgaagttgca
aatactgagaagaaagttccgttggaatggattaaacctgacggagcaggccttacagaa
gactttattaagtatgctcttccgttaattcagggagaatcaagacctcctatcgaagat
ggtcttccaagatttgcaaaactgaaaaaggttcttgcaagaaaataa

DBGET integrated database retrieval system