KEGG   Ruminiclostridium thermocellum ATCC 27405: Cthe_0423Help
Entry
Cthe_0423         CDS       T00474                                 

Definition
bifunctional acetaldehyde-CoA/alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
cth  Ruminiclostridium thermocellum ATCC 27405
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:cth00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Cthe_0423
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cthe_0423
   00620 Pyruvate metabolism
    Cthe_0423
   00650 Butanoate metabolism
    Cthe_0423
  Lipid metabolism
   00071 Fatty acid degradation
    Cthe_0423
  Amino acid metabolism
   00350 Tyrosine metabolism
    Cthe_0423
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Cthe_0423
   00626 Naphthalene degradation
    Cthe_0423
Enzymes [BR:cth01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Cthe_0423
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Cthe_0423
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
531351..533972
Genome map
AA seq 873 aa AA seqDB search
MTKIANKYEVIDNVEKLEKALKRLREAQSVYATYTQEQVDKIFFEAAMAANKMRIPLAKM
AVEETGMGVVEDKVIKNHYASEYIYNAYKNTKTCGVIEEDPAFGIKKIAEPLGVIAAVIP
TTNPTSTAIFKTLIALKTRNAIIISPHPRAKNSTIEAAKIVLEAAVKAGAPEGIIGWIDV
PSLELTNLVMREADVILATGGPGLVKAAYSSGKPAIGVGAGNTPAIIDDSADIVLAVNSI
IHSKTFDNGMICASEQSVIVLDGVYKEVKKEFEKRGCYFLNEDETEKVRKTIIINGALNA
KIVGQKAHTIANLAGFEVPETTKILIGEVTSVDISEEFAHEKLCPVLAMYRAKDFDDALD
KAERLVADGGFGHTSSLYIDTVTQKEKLQKFSERMKTCRILVNTPSSQGGIGDLYNFKLA
PSLTLGCGSWGGNSVSDNVGVKHLLNIKTVAERRENMLWFRTPEKIYIKRGCLPVALDEL
KNVMGKKKAFIVTDNFLYNNGYTKPITDKLDEMGIVHKTFFDVSPDPSLASAKAGAAEML
AFQPDTIIAVGGGSAMDAAKIMWVMYEHPEVDFMDMAMRFMDIRKRVYTFPKMGQKAYFI
AIPTSAGTGSEVTPFAVITDEKTGIKYPLADYELLPDMAIVDADMMMNAPKGLTAASGID
ALTHALEAYVSMLATDYTDSLALRAIKMIFEYLPRAYENGASDPVAREKMANAATIAGMA
FANAFLGVCHSMAHKLGAFYHLPHGVANALMINEVIRFNSSEAPTKMGTFPQYDHPRTLE
RYAEIADYIGLKGKNNEEKVENLIKAIDELKEKVGIRKTIKDYDIDEKEFLDRLDEMVEQ
AFDDQCTGTNPRYPLMNEIRQMYLNAYYGGAKK
NT seq 2622 nt NT seq  +upstreamnt  +downstreamnt
atgacgaaaatagcgaataaatacgaagttattgataatgttgaaaagcttgaaaaggct
ttgaaacgtttaagagaagctcaaagtgtttatgcaacctatacacaggagcaggttgac
aaaattttctttgaggcggcaatggcggccaataaaatgagaattcctcttgccaaaatg
gctgtggaggaaacaggcatgggagtggttgaagacaaggttatcaaaaaccactatgct
tctgagtatatctataatgcgtacaaaaacactaaaacctgcggtgttattgaagaggac
cctgctttcggtattaaaaaaatagcagagcctttgggggttattgcggcggttatacct
actacgaatccgacatcgacagcaatctttaagactcttattgcattaaagacgagaaat
gcaattattataagcccacaccccagggcaaaaaactcaacgatagaagcggcgaaaatt
gttttggaggcggccgttaaagccggtgctccggaaggcatcattggctggattgatgtg
ccgagccttgaacttaccaacctggtaatgagagaagcagatgtgattctcgcaacaggc
ggtcccggactggttaaagcagcttactcttcgggcaaaccggctattggtgtcggagcg
ggcaatactcctgcaattattgatgattcggccgacattgtcttggcagtgaactcaata
atacattcaaaaactttcgacaacggtatgatttgtgcttcagagcaatcggtcattgtt
ctggacggggtatataaagaggtaaaaaaagaatttgaaaaaagaggatgctatttctta
aatgaagatgaaactgaaaaggtaagaaaaacaattataataaacggtgcgttaaatgcc
aagatagtaggtcagaaagctcacacaattgcaaaccttgcaggttttgaggtacccgag
actacaaaaattctgataggcgaagttaccagcgtggatatttccgaagaatttgcccac
gaaaagttgtgcccggtactggcaatgtacagggcaaaggattttgacgatgcccttgat
aaagcagaaaggttggtagctgacggtggatttggccatacttcgtcactttatatagat
acggtaacacagaaagagaaacttcagaaattctctgaaaggatgaaaacctgccgtata
ttggttaatacgccgtcatcccagggaggtatcggtgacctttacaacttcaagcttgct
ccgtctctcaccctcggctgcggttcctggggaggaaattcagtttccgacaatgtggga
gtcaagcatttgttaaacattaaaacagttgccgagaggagagagaacatgctctggttc
agaacacctgaaaagatttatataaaaagaggttgtctgcctgttgcattggatgagctt
aaaaatgtaatgggtaaaaagaaagcatttattgtaacggataacttcctgtacaataac
ggctacaccaagccgattacggataagctggatgaaatgggaattgtgcacaagaccttc
tttgatgtgtctccagacccatcccttgcatctgccaaagccggtgcggcagaaatgctg
gctttccagcctgacaccataattgcggtcggcggcggatctgccatggacgcggccaaa
atcatgtgggtgatgtatgaacatccggaagttgactttatggacatggcaatgagattt
atggatataagaaagagagtttacaccttcccgaagatgggacagaaggcatactttatc
gcaattccgacttccgcgggtacaggttcagaagtgacaccttttgcggttattactgat
gaaaaaacaggaattaaataccctctggccgactatgaattgttgccggacatggctatt
gtagatgccgatatgatgatgaatgctccaaagggacttaccgcagcttccggtatagac
gcattgacccacgctctggaagcctatgtttcaatgcttgcgaccgactatacggatagc
cttgcccttcgtgcaataaagatgatatttgaatatctcccgagagcctatgaaaacggt
gcaagtgacccggttgcaagagagaaaatggccaatgccgcaacaatagccggaatggct
tttgccaatgcctttttgggtgtatgccattcaatggcgcacaaactgggtgctttttat
cacctgccccacggtgttgccaatgcacttatgataaacgaagtaatcagattcaactca
tccgaggctccgaccaagatgggtactttcccgcagtatgaccatccgcgcacgctggaa
aggtatgcagaaattgccgattatatcggacttaagggcaagaataacgaagaaaaagtt
gaaaacttgattaaagctattgatgagcttaaagaaaaggtgggcatcaggaagaccatc
aaagattatgacatagatgaaaaggaatttttggacagactggacgaaatggtggaacag
gcttttgacgaccagtgcacaggtacaaatccaagatacccgcttatgaatgaaatcagg
caaatgtatctgaacgcttattacggaggtgcgaagaaatga

DBGET integrated database retrieval system