KEGG   Ruminiclostridium thermocellum ATCC 27405: Cthe_0441Help
Entry
Cthe_0441         CDS       T00474                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
cth  Ruminiclostridium thermocellum ATCC 27405
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cth00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Cthe_0441
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Cthe_0441
Enzymes [BR:cth01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     Cthe_0441
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
556327..557190
Genome map
AA seq 287 aa AA seqDB search
MGVKVHDAHHGFLYCEVDKIKGCEIQLDFPSVGATENIMLAAVFAEGETVIRHAAKEPEI
VDLQNFLVGMGADVSGAGTSTITIRGTNRKLNNVEHTVIPDRIVAGTYLVAAGITGGELN
LKNVMPEHITSVVSYLRESGCRINIKRNNIHISGPSRPKAIDIIRTLPYPGFPTDMQSQF
VSLLSVARGTSIIVETIFENRYKHVEELLRMGADIKLEGRLAVIKGVKRLTGATVTARDL
RGGAALVLAALAAEGTSIISGIKHIDRGYENIEGKLSMVGAIIKREE
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgggggtcaaggtgcacgatgcacatcacggatttttatactgtgaagttgataaaatt
aaaggatgcgagattcaactggattttcccagtgtgggagccacagagaatataatgctg
gctgcggtttttgccgagggcgagactgttatacggcatgcagccaaggagcctgaaatc
gtagaccttcagaattttcttgtaggaatgggtgcggatgtgtcaggagcgggaaccagt
accataacgatacgaggtacgaacaggaaacttaataatgttgagcacactgttataccc
gacaggatagttgcaggtacatatttggtggcggcagggattaccggaggagaattgaat
ctaaagaatgttatgccggagcatataacgtccgtggtgtcatatcttcgggaaagcgga
tgcaggatcaacataaaacggaacaatatacatatttcaggtcccagcaggccgaaggct
attgacataatcaggactctgccatatccgggttttcccaccgatatgcagtcgcagttt
gtttctctgctttcggttgccagaggaaccagcattatagttgagaccatatttgagaac
cggtacaaacatgttgaggaactattgagaatgggagccgacataaagcttgaaggaagg
ctggcggtaataaaaggagtaaaaaggcttaccggggcaactgttacagccagggactta
agaggaggagctgctttggttcttgcggcgctggcagctgaaggtaccagcataataagc
ggaataaaacatatcgacagaggttatgaaaatattgaaggaaagctttccatggtcgga
gctataattaaaagagaagaataa

DBGET integrated database retrieval system