KEGG   Ruminiclostridium thermocellum ATCC 27405: Cthe_0489Help
Entry
Cthe_0489         CDS       T00474                                 

Definition
response regulator receiver modulated CheB methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
cth  Ruminiclostridium thermocellum ATCC 27405
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:cth00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Cthe_0489
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Cthe_0489
Enzymes [BR:cth01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Cthe_0489
Two-component system [BR:cth02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Cthe_0489
Bacterial motility proteins [BR:cth02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Cthe_0489
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
602289..603353
Genome map
AA seq 354 aa AA seqDB search
MIWNLKQKITVLVVDDSAFMRKVISDILNSDEEIKVIDTAKNGLEAIEKAQKLKPDVITL
DLKMPVMDGLECLRKLNETMRIPVIMLSSITKEGAEATIQALAEGAMDFVAKPENIFDMK
EERIKNEIIEKVKIAKNYKYFKSDKKSTGTVIKANTTQSRIRNIVVIGTSTGGPRALQDV
LPLFPANVDAAFLIVQHMPGGFTKSLAERLDSMCNVKVKEAEDDEIIENSHVYIAPGDFH
MLLEKNGNDTFKIKLSKDPPLGGHRPSVDVMMESVSNTGFKNVVAVIMTGMGRDGSEGIK
KLKSVNNAYIIAQDESSCVVFGMPRVAISTGVVDVVVPLKEIANEIMKIVGVHE
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgatttggaatctgaagcaaaaaatcactgtgttggtagttgacgattcagcctttatg
agaaaagtaatatcggatattctaaacagcgatgaagaaatcaaggttattgatacagca
aaaaacggtcttgaggctattgaaaaggcgcaaaagctaaaaccggacgttattaccctg
gacttgaagatgcctgttatggacggcctcgagtgcttaagaaaactgaatgaaaccatg
cgcattccggttattatgttaagcagcattaccaaggagggagcggaggcaaccattcag
gctttggccgaaggagcaatggactttgttgcaaaacctgaaaacatatttgatatgaaa
gaagaaagaataaagaatgagataattgaaaaagtaaaaattgcaaaaaactacaaatat
tttaaaagcgacaaaaagagcacgggtactgtaataaaagccaatacaacccaaagcagg
attcgcaatatcgtagttattggtacttccaccggcggaccgagggcacttcaggatgtt
ttgccgctttttccggcaaatgtggacgcagcttttttgatagtacagcacatgcccgga
ggattcacaaaatctttggctgaaagacttgattccatgtgcaatgtaaaggtaaaagaa
gctgaagatgatgagattattgaaaattcccatgtatacattgctcccggagacttccat
atgcttcttgagaagaatggcaatgatacatttaaaataaagctttccaaagatcccccg
ttgggaggtcacagaccgtctgttgatgtaatgatggaatcggtgtccaatacaggattt
aaaaatgttgttgcggtcataatgacagggatgggacgggacggaagtgaaggcatcaaa
aagctcaagagtgtaaacaatgcatatataattgcacaggatgaaagctcatgcgttgta
tttggtatgccaagggtcgcaattagcaccggagtagtggatgttgttgtaccgctgaaa
gaaatagcgaatgagattatgaaaatagtgggggtgcatgaataa

DBGET integrated database retrieval system