KEGG   Ruminiclostridium thermocellum ATCC 27405: Cthe_0551Help
Entry
Cthe_0551         CDS       T00474                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
cth  Ruminiclostridium thermocellum ATCC 27405
Pathway
cth00010  Glycolysis / Gluconeogenesis
cth00620  Pyruvate metabolism
cth00640  Propanoate metabolism
cth00680  Methane metabolism
cth01100  Metabolic pathways
cth01110  Biosynthesis of secondary metabolites
cth01120  Microbial metabolism in diverse environments
cth01130  Biosynthesis of antibiotics
cth01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cth00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cthe_0551
   00620 Pyruvate metabolism
    Cthe_0551
   00640 Propanoate metabolism
    Cthe_0551
  Energy metabolism
   00680 Methane metabolism
    Cthe_0551
Enzymes [BR:cth01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Cthe_0551
Lipid biosynthesis proteins [BR:cth01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Cthe_0551
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: ABN51787
JGI: Cthe_0551
UniProt: A3DCV8
Position
complement(673111..674775)
Genome map
AA seq 554 aa AA seqDB search
MLEKYLSKVNFNSYDDFVQNFKLNIPENFNFAYDVADEIADKTPEKVALVWCNDRGEEAT
FTFGQLKEYSNKAANFFKRVGIKKGDRVMLILKRRYEFWFAILALHKIGAACIPATHLLT
AKDIIYRNNAADIKMIVCVGEDEVIKHVEESLEQSPTVMAKALIGRDKEGWYNFNKEIEN
ESSHFERPTGKDATTNDDIMLLYFTSGTTGMPKMVAHDFTYPLGHIVTAKYWQNVIDGGL
HLTVADTGWAKAAWGKIYGQWIAGSAVFVYDYDNKFVPKDLLDVICKYGVTTFCAPPTIY
RFFIKEDLTKYDFSKLKYCTVAGEPLNPEVYNQFYKATGIKLMEGYGQTELTLTIGTFPW
MEPKPGSMGKPSAGYVIDILDENGNPCEVGEEGQIVIRTDKSKPIGMFDGYYRDTELTKK
VWHDDIYYTGDMAWRDEDGYFWFVGRADDVIKSSGYRIGPFEVESALLEHPAVLECAITA
VPDPIRGQVVKATVVLAKNYSPCDELVKELQEHVKKVTAPYKYPRIIEFVDELPKTISGK
IRRVEIRNKDQAKK
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgttagagaaatatttgtcaaaagtaaattttaattcatatgacgattttgttcaaaat
tttaaattgaacattcctgaaaatttcaattttgcttatgatgttgccgacgaaattgca
gacaaaactcctgaaaaagtggcattagtctggtgtaatgataggggcgaggaagcaaca
tttactttcggccaattaaaagagtacagcaacaaagccgcaaatttctttaagagagtg
ggaataaaaaaaggcgaccgtgtaatgcttattttaaaaaggcgttacgaattctggttt
gcaattctcgctcttcacaagataggcgcggcatgcataccggccactcatcttcttacc
gcaaaagacataatttacagaaacaatgcggctgacatcaaaatgattgtatgtgttggc
gaagacgaagtaataaaacacgttgaagaatcactggagcaatcacccactgttatggca
aaagctcttatcggcagagacaaggaaggctggtacaactttaacaaagaaatcgaaaac
gaatcttcacattttgaaagaccaacaggcaaagatgcaacaactaatgacgatatcatg
cttttgtactttacttcaggaaccaccggaatgccaaaaatggtggcccatgactttact
tatcctttgggccatattgtaaccgccaaatactggcagaatgtaattgacggcggactg
caccttaccgttgcggacactggatgggcaaaagccgcctggggtaaaatctacggtcaa
tggattgccggaagtgctgtttttgtatacgactatgataacaaatttgttccaaaggat
cttctcgatgtaatatgcaagtatggtgttactactttctgtgcacctcctacaatttac
aggttctttataaaagaggacttaaccaaatatgatttcagcaagctgaaatattgtacc
gttgcaggtgaaccactgaatcctgaagtatacaaccagttttacaaagcaacgggcatc
aagcttatggaaggatatggtcagacagagcttactttgaccataggtacattcccctgg
atggaacccaagccaggttcaatgggcaagccgtctgcaggctatgtcatagatattctt
gacgaaaatggcaatccttgcgaagtcggtgaggaaggccagatagttataagaacggat
aaaagcaaacctataggaatgtttgacggatattacagggatactgagcttacaaaaaag
gtatggcacgatgatatctattataccggagacatggcttggcgcgatgaggatggttat
ttctggtttgtcggcagggctgatgacgttataaagagctccggatacagaatcgggcct
tttgaagtagaaagcgcccttttggagcatcccgcggttttggaatgcgcaataacagct
gtcccggatcctatcagaggtcaggtggttaaagccactgtcgttcttgccaaaaattat
tctccttgcgatgaacttgtaaaggaacttcaggagcatgtcaagaaagtaaccgcacct
tacaagtaccccagaattatcgagtttgttgatgagcttccaaaaaccataagcggaaaa
atcagaagagtggaaatcagaaacaaggaccaggcaaaaaaataa

DBGET integrated database retrieval system