KEGG   Ruminiclostridium thermocellum ATCC 27405: Cthe_0609Help
Entry
Cthe_0609         CDS       T00474                                 

Definition
peptidase M42
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
cth  Ruminiclostridium thermocellum ATCC 27405
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cth00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Cthe_0609
Enzymes [BR:cth01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Cthe_0609
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
746423..747400
Genome map
AA seq 325 aa AA seqDB search
MFDLLKKFTGIVGVSGNEEEIREAIIEEIKECVDEIKVDTLGNLIAVKKGKGKKIMVAAH
MDEIGVMVTYIDDKGFLRFSAVGGVSRYDCIGQRVKFKNGVVGAVYYEEKLEDMKNLQLS
KMYIDIGARSREEALKMVNIGDVACFVGDAVLQGDTVISKALDNRSGCAVVVKAIKELKK
TDNEIYFVFTVQEEVGLRGAKTAAFSIKPDIAIAVDVTMTGDTPESHPMEVKCGGGPAIK
VKDRSVICHPEVRKLLEESAKRNNIPYQLEILEAGGSDPGSIHLTAGGIPSGAISIPVRY
VHSPVETASMSDINNAVKLLVEAIC
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgtttgacttgctcaaaaagtttacaggaatcgttggagtatccggaaacgaagaagaa
ataagggaagctataattgaggaaattaaagaatgtgttgacgaaataaaagttgatact
ttgggaaaccttattgccgtcaaaaaaggcaagggcaaaaaaatcatggtggcggctcat
atggatgagattggcgtaatggttacatatatagacgacaagggctttttaaggttttct
gccgtcggaggggtcagccgctatgactgtataggccagagggtgaagtttaaaaacgga
gttgtcggagctgtttattacgaggaaaaacttgaggatatgaagaatctccagctttcc
aaaatgtatatagatattggagcaagaagcagagaggaagccctgaagatggtaaatatc
ggagatgtcgcctgctttgtcggagatgcggtgcttcagggggataccgtgatatcgaag
gcattggacaacagaagcggctgtgcggtggttgtaaaggcgataaaagagttgaaaaag
acggataatgaaatatattttgtgtttacggttcaggaagaggtcggtttgagaggagca
aaaaccgcggctttcagtataaagcctgatatagccatagctgtggatgttacaatgacg
ggagacacaccggaatcgcatcctatggaggttaagtgcggcggcgggcctgcaattaaa
gtaaaggatcgttccgtcatttgtcatccggaggtaagaaaacttttggaagagtcagca
aaaaggaataatattccttatcagttggaaatacttgaagcaggagggagcgacccgggc
tcaatacatttgacggcgggaggaataccttcgggtgcgatatccataccggtgaggtat
gttcacagtccggtagagaccgccagcatgtcggatattaataatgccgtaaaattgttg
gttgaagccatttgctga

DBGET integrated database retrieval system