KEGG   Ruminiclostridium thermocellum ATCC 27405: Cthe_0609Help
Entry
Cthe_0609         CDS       T00474                                 

Definition
(GenBank) peptidase M42 family protein
Organism
cth  Ruminiclostridium thermocellum ATCC 27405
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
746423..747400
Genome map
AA seq 325 aa AA seqDB search
MFDLLKKFTGIVGVSGNEEEIREAIIEEIKECVDEIKVDTLGNLIAVKKGKGKKIMVAAH
MDEIGVMVTYIDDKGFLRFSAVGGVSRYDCIGQRVKFKNGVVGAVYYEEKLEDMKNLQLS
KMYIDIGARSREEALKMVNIGDVACFVGDAVLQGDTVISKALDNRSGCAVVVKAIKELKK
TDNEIYFVFTVQEEVGLRGAKTAAFSIKPDIAIAVDVTMTGDTPESHPMEVKCGGGPAIK
VKDRSVICHPEVRKLLEESAKRNNIPYQLEILEAGGSDPGSIHLTAGGIPSGAISIPVRY
VHSPVETASMSDINNAVKLLVEAIC
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgtttgacttgctcaaaaagtttacaggaatcgttggagtatccggaaacgaagaagaa
ataagggaagctataattgaggaaattaaagaatgtgttgacgaaataaaagttgatact
ttgggaaaccttattgccgtcaaaaaaggcaagggcaaaaaaatcatggtggcggctcat
atggatgagattggcgtaatggttacatatatagacgacaagggctttttaaggttttct
gccgtcggaggggtcagccgctatgactgtataggccagagggtgaagtttaaaaacgga
gttgtcggagctgtttattacgaggaaaaacttgaggatatgaagaatctccagctttcc
aaaatgtatatagatattggagcaagaagcagagaggaagccctgaagatggtaaatatc
ggagatgtcgcctgctttgtcggagatgcggtgcttcagggggataccgtgatatcgaag
gcattggacaacagaagcggctgtgcggtggttgtaaaggcgataaaagagttgaaaaag
acggataatgaaatatattttgtgtttacggttcaggaagaggtcggtttgagaggagca
aaaaccgcggctttcagtataaagcctgatatagccatagctgtggatgttacaatgacg
ggagacacaccggaatcgcatcctatggaggttaagtgcggcggcgggcctgcaattaaa
gtaaaggatcgttccgtcatttgtcatccggaggtaagaaaacttttggaagagtcagca
aaaaggaataatattccttatcagttggaaatacttgaagcaggagggagcgacccgggc
tcaatacatttgacggcgggaggaataccttcgggtgcgatatccataccggtgaggtat
gttcacagtccggtagagaccgccagcatgtcggatattaataatgccgtaaaattgttg
gttgaagccatttgctga

DBGET integrated database retrieval system