KEGG   Clostridium thermocellum ATCC 27405: Cthe_0678Help
Entry
Cthe_0678         CDS       T00474                                 

Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
cth  Clostridium thermocellum ATCC 27405
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:cth00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
833900..835201
Genome map
AA seq 433 aa AA seqDB search
MRMVDLINKKKRGEALSAAEIDYIVQGYTKGEIPDYQMSAFLMAVYFKGMNREETANLTL
SMVNSGETVDLSMIEGIKVDKHSSGGVGDKISLVIVPLCACVGIPVAKMSGRGLGHTGGT
IDKLESIEGFRTELTKEEFVNNVNKYKMAIVGQSPNLTPADKKIYALRDVTGTVDSIPLI
ASSIMSKKIASGCDCIVLDVKVGSGAFMKSVDEAVILAKTMVEIGKALGRRTVAVVTDMS
QPLGYEVGNANEVKEAIEILKGHGAEDETTVALTIASHMAVLGGAFSDYESAYNHMRKLI
ESGKAVEKLKELIRIQGGNTDVVDNPNLLPQAEKHIEVKSSTAGYINSVNAEDIGVSAML
LGAGRKTKNDSIDFSAGITMVKKIGDWVDEGDTLCILHTNKSDFQEAERLSKNAFVIKNT
KPEPIKYVHCVID
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgagaatggttgatcttataaacaaaaaaaagcggggagaagctctgtccgccgctgaa
attgattatattgtccaaggctatacaaagggcgaaataccggactatcagatgtcggca
tttttgatggctgtatatttcaaaggaatgaacagagaagagacggcaaaccttacttta
tccatggtcaattccggtgaaacggttgacctttcgatgattgaaggaataaaggttgac
aagcattcttccggtggcgttggagacaaaatcagtcttgtaatagttccgctttgtgcc
tgtgttgggataccggttgcaaaaatgtccggaagagggcttgggcacaccggcggaaca
attgataagctggaatccatagaaggatttagaaccgagcttacgaaagaggagtttgtg
aacaacgtaaacaaatataaaatggccatagtaggccaatcgccaaatctcactcctgcg
gacaaaaaaatatatgctctgagagatgttaccggtacggtggacagcataccgcttata
gcaagctcaataatgagtaaaaaaatcgcctccgggtgcgattgcattgtcctggatgtc
aaggtgggatccggagccttcatgaagtccgtggacgaagccgtgattttggcaaaaacc
atggtggaaataggcaaagctttgggaagaagaactgttgcggttgtaacagacatgagc
cagcctttgggatatgaagtgggaaacgccaacgaagttaaagaagcaatagaaatattg
aagggccacggtgccgaggacgagacaacggtggcactcacaattgcatcccatatggcg
gtattgggcggtgctttttcagattatgaatcggcttacaaccatatgcgcaaattgata
gaatccggcaaggcagtggaaaaattaaaggaattaatcagaatacaggggggaaatacc
gatgtggtggacaacccaaatcttttaccccaggccgaaaaacacatagaagttaaatcc
tcaacggcaggttatataaattctgtcaatgccgaggacataggagtttcggcaatgctt
cttggagcaggaagaaagaccaaaaacgacagcatagatttttcagcgggcatcacaatg
gtaaaaaagattggggattgggttgatgaaggtgatactttgtgcatacttcacacaaac
aagtccgactttcaagaggcagaaaggctttccaaaaatgcttttgtcataaaaaacacg
aaacctgaaccgattaaatatgttcactgtgttattgactga

DBGET integrated database retrieval system