KEGG   Ruminiclostridium thermocellum ATCC 27405: Cthe_0695Help
Entry
Cthe_0695         CDS       T00474                                 

Definition
agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
cth  Ruminiclostridium thermocellum ATCC 27405
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:cth00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Cthe_0695
Enzymes [BR:cth01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Cthe_0695
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
853324..854193
Genome map
AA seq 289 aa AA seqDB search
MSLRNGNSTLPTKFMASIDSYDDASIVMAGVPMDFTCSFRPGTRFGPQKIREVSIGIEEY
SVYMDRDLTQCSFFDAGDLDLPFGDVDKSLKLIGDVAEEILSDNKFPLFIGGEHLISVPV
IKKVYEKYGPELIVVQFDAHADLREGYLGCPNSHASAVRRLIDFMPGKNIYQFGIRSGTK
DEFEYAKKHTNMYTIDVFEPLSRVLDDIKDKPIYITLDIDVVDPAYANGTGTPEPGGISS
RELLDSIHLFKGANLVGFDIVEVSPHYDQSDRTALLAAKIIREIIMMVG
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgagtttaagaaacgggaattctacattgccgaccaaatttatggcaagcattgacagc
tacgatgatgcatccatagtcatggccggtgttccaatggactttacctgcagcttcaga
ccgggaacaaggtttggaccgcagaaaatcagggaagtatccataggcattgaagaatac
agcgtatacatggaccgggatttgacccagtgttctttctttgatgccggtgacttggat
cttcccttcggtgacgtggataaaagcttgaaacttatcggggacgtggcagaagagata
ctcagcgacaataaatttccactctttatcggtggagagcatcttatcagcgtaccggta
ataaaaaaggtgtatgaaaaatacggacctgaactgatagtggtgcagtttgacgcccat
gcagacctcagggaaggatatctgggatgcccaaactctcatgcttcggctgtaagacgc
ttgattgactttatgccgggaaaaaatatttatcagttcggtataaggtccggaacgaaa
gacgagtttgaatatgcaaaaaaacataccaacatgtatactatcgacgtttttgagccg
ttaagccgtgtcttagacgatatcaaggacaagcccatatacataacccttgacatcgac
gtggtagaccctgcatacgcgaacggtactggtacaccggagcccggcgggatcagctcc
agggaacttttggattcaatacatctgttcaagggagcaaatcttgtcggatttgacatt
gtggaagtatcaccccactatgatcaatctgaccggacggcgctccttgcggcaaaaatt
atcagagaaatcattatgatggtcggatga

DBGET integrated database retrieval system