KEGG   Ruminiclostridium thermocellum ATCC 27405: Cthe_0695Help
Entry
Cthe_0695         CDS       T00474                                 

Definition
(GenBank) agmatinase
  KO
K01480  agmatinase [EC:3.5.3.11]
Organism
cth  Ruminiclostridium thermocellum ATCC 27405
Pathway
cth00330  Arginine and proline metabolism
cth01100  Metabolic pathways
Module
cth_M00133  Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:cth00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Cthe_0695
Enzymes [BR:cth01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Cthe_0695
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase Staphopain_pro
Motif
Other DBs
NCBI-ProteinID: ABN51930
JGI: Cthe_0695
UniProt: A3DDA1
Position
853324..854193
Genome map
AA seq 289 aa AA seqDB search
MSLRNGNSTLPTKFMASIDSYDDASIVMAGVPMDFTCSFRPGTRFGPQKIREVSIGIEEY
SVYMDRDLTQCSFFDAGDLDLPFGDVDKSLKLIGDVAEEILSDNKFPLFIGGEHLISVPV
IKKVYEKYGPELIVVQFDAHADLREGYLGCPNSHASAVRRLIDFMPGKNIYQFGIRSGTK
DEFEYAKKHTNMYTIDVFEPLSRVLDDIKDKPIYITLDIDVVDPAYANGTGTPEPGGISS
RELLDSIHLFKGANLVGFDIVEVSPHYDQSDRTALLAAKIIREIIMMVG
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgagtttaagaaacgggaattctacattgccgaccaaatttatggcaagcattgacagc
tacgatgatgcatccatagtcatggccggtgttccaatggactttacctgcagcttcaga
ccgggaacaaggtttggaccgcagaaaatcagggaagtatccataggcattgaagaatac
agcgtatacatggaccgggatttgacccagtgttctttctttgatgccggtgacttggat
cttcccttcggtgacgtggataaaagcttgaaacttatcggggacgtggcagaagagata
ctcagcgacaataaatttccactctttatcggtggagagcatcttatcagcgtaccggta
ataaaaaaggtgtatgaaaaatacggacctgaactgatagtggtgcagtttgacgcccat
gcagacctcagggaaggatatctgggatgcccaaactctcatgcttcggctgtaagacgc
ttgattgactttatgccgggaaaaaatatttatcagttcggtataaggtccggaacgaaa
gacgagtttgaatatgcaaaaaaacataccaacatgtatactatcgacgtttttgagccg
ttaagccgtgtcttagacgatatcaaggacaagcccatatacataacccttgacatcgac
gtggtagaccctgcatacgcgaacggtactggtacaccggagcccggcgggatcagctcc
agggaacttttggattcaatacatctgttcaagggagcaaatcttgtcggatttgacatt
gtggaagtatcaccccactatgatcaatctgaccggacggcgctccttgcggcaaaaatt
atcagagaaatcattatgatggtcggatga

DBGET integrated database retrieval system