KEGG   Clostridium thermocellum ATCC 27405: Cthe_0711Help
Entry
Cthe_0711         CDS       T00474                                 

Definition
chorismate mutase (EC:5.4.99.5)
Orthology
K06208  
chorismate mutase [EC:5.4.99.5]
Organism
cth  Clostridium thermocellum ATCC 27405
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:cth01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:cth00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Structure
PDB: 

Jmol
Position
867331..867687
Genome map
AA seq 118 aa AA seqDB search
MVWAIRGATTVSDNTADEIVAETQKLLKEMAEKNGLEEDDIISIIFTVTKDLDAAFPAIA
ARNMGWTSTALMCMNEIDVPGSLEKCIRVMMHVNTDKDKKDIKHVYLNGAKVLRPDLT
NT seq 357 nt NT seq  +upstreamnt  +downstreamnt
atggtatgggctatcagaggtgcgaccactgtttcagacaacactgcggatgaaatagtg
gctgaaactcaaaaactgcttaaagaaatggccgaaaaaaacggacttgaggaagatgac
ataataagtattatttttaccgttacaaaagatttggatgctgcattcccggcaattgca
gcaagaaatatgggatggacaagtacggcacttatgtgcatgaacgaaatagatgttccg
ggaagcctggagaaatgcatcagagtaatgatgcacgtaaacaccgataaagacaagaaa
gatataaaacatgtataccttaacggtgcaaaggtgttaaggccggatttgacttaa

DBGET integrated database retrieval system