KEGG   Ruminiclostridium thermocellum ATCC 27405: Cthe_0711Help
Entry
Cthe_0711         CDS       T00474                                 

Definition
(GenBank) chorismate mutase
  KO
K06208  chorismate mutase [EC:5.4.99.5]
Organism
cth  Ruminiclostridium thermocellum ATCC 27405
Pathway
cth00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cth01100  Metabolic pathways
cth01110  Biosynthesis of secondary metabolites
cth01130  Biosynthesis of antibiotics
cth01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cth00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Cthe_0711
Enzymes [BR:cth01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.5  chorismate mutase
     Cthe_0711
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CM_1
Motif
Other DBs
NCBI-ProteinID: ABN51946
JGI: Cthe_0711
UniProt: A3DDB7
Structure
PDB: 

Jmol
Position
867331..867687
Genome map
AA seq 118 aa AA seqDB search
MVWAIRGATTVSDNTADEIVAETQKLLKEMAEKNGLEEDDIISIIFTVTKDLDAAFPAIA
ARNMGWTSTALMCMNEIDVPGSLEKCIRVMMHVNTDKDKKDIKHVYLNGAKVLRPDLT
NT seq 357 nt NT seq  +upstreamnt  +downstreamnt
atggtatgggctatcagaggtgcgaccactgtttcagacaacactgcggatgaaatagtg
gctgaaactcaaaaactgcttaaagaaatggccgaaaaaaacggacttgaggaagatgac
ataataagtattatttttaccgttacaaaagatttggatgctgcattcccggcaattgca
gcaagaaatatgggatggacaagtacggcacttatgtgcatgaacgaaatagatgttccg
ggaagcctggagaaatgcatcagagtaatgatgcacgtaaacaccgataaagacaagaaa
gatataaaacatgtataccttaacggtgcaaaggtgttaaggccggatttgacttaa

DBGET integrated database retrieval system