KEGG   Clostridium thermocellum ATCC 27405: Cthe_1211Help
Entry
Cthe_1211         CDS       T00474                                 

Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
cth  Clostridium thermocellum ATCC 27405
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:cth01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:cth00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:cth00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1445603..1446967)
Genome map
AA seq 454 aa AA seqDB search
MSKKDVTKVVLDESDIPKQWYNILADMPNKPAPYFSSKTGKPVTLDELQAIFPMELIQQE
NSQERWIDIPEEVREMYRQWRPSPLYRARALEKHLGTPARIYYKYEGTNATGSHKLNTSL
PQAYYNKIAGIKRLSTETGAGQWGSALSLACNHFGLECTVYMVKVSYEQKPYRRSFMKTF
GAQVYASPTNLTSSGRAILEKDPDCTGSLGIAISEAVEDAATHDDTNYALGSVLNHVCLH
QTIIGLEAKKQLEYLDEYPDVVFACCGGGSNFAGIAFPFLMDKFKGTKVRAVAVEPTACP
TLTKGVYAYDYSDTGKIGPLAKMYTVGHDFVPAGIHAGGLRYHGVSPIVSQLYEDKLIEA
KAYGQSSVFEAAVIFARTEGIVPAPESSHAIRAAIDEALLCKESGEAKVILFNLSGHGYF
DMAAYDNYFSGKLSDVDYSEEEIARSMKNLPKVD
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaaaagatgtaaccaaggtagttttagatgagtcggatattccaaagcaatgg
tacaatattttggcagacatgcccaacaagcccgcaccttacttcagctcaaaaaccggc
aaaccggttacgttggacgaacttcaggcaattttcccgatggaactgattcaacaggaa
aattcccaggagagatggattgacattccggaagaagtaagagaaatgtaccgtcaatgg
agaccgagtccgttgtacagggctagggctctggaaaagcatttggggactcctgccaga
atctattacaaatatgaaggaacgaacgcaaccggaagccacaagcttaacacttcattg
ccgcaggcttattacaacaagattgccggcataaaaagactttcaacggagaccggcgca
ggacagtggggaagtgcactgagccttgcatgcaatcatttcggacttgagtgtacggtt
tacatggttaaggtaagttatgagcaaaagccctacagacgttctttcatgaaaactttc
ggagcccaggtgtatgcaagtcctaccaatcttacaagcagcggcagggcgattttggaa
aaagatcctgattgtaccggaagtctcggtattgcgataagtgaagctgttgaagatgcg
gctacgcacgatgataccaattatgccttgggaagtgttttaaatcacgtatgtttgcat
cagaccattatcggtcttgaggccaagaagcagttggaatatctggatgaataccctgat
gtggtctttgcctgctgcggcggaggatcaaactttgccggaatagcttttccgttcctg
atggacaagtttaagggaacaaaagtgagagcagtggctgttgaaccgactgcatgcccc
actctcacaaaaggtgtgtatgcttatgattattccgacacgggaaagatcggtccgttg
gcaaagatgtatacggttggtcatgactttgtacctgccggtatccatgcaggcgggttg
agatatcacggagtttcaccaatagtcagccagctttatgaggataagttgattgaagca
aaagcttacggacagagttcggtttttgaagcggctgttatttttgcaagaacggaagga
attgttcccgctcctgagtcttcccatgcaataagggctgctattgacgaagccctgttg
tgcaaagaatcgggagaggcgaaagttattctgtttaatttgagtggacacggatatttt
gacatggccgcttatgacaactactttagcggaaaacttagtgacgtggattattcggaa
gaggaaattgcaagaagtatgaaaaatttgccaaaggttgactaa

DBGET integrated database retrieval system