KEGG   Ruminiclostridium thermocellum ATCC 27405: Cthe_1226Help
Entry
Cthe_1226         CDS       T00474                                 

Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
cth  Ruminiclostridium thermocellum ATCC 27405
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cth00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Cthe_1226
   00670 One carbon pool by folate
    Cthe_1226
Enzymes [BR:cth01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     Cthe_1226
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1466748..1467251)
Genome map
AA seq 167 aa AA seqDB search
MKAIVAVDSNWGIGYKGNLLQRIPEDMRFFRQMTLNKVVVMGRKTFESLPGKEPLKDRVN
IILSKSENIEKDGIIICRSVDGLFLELKKYNSDDIFVIGGEEVYTQLLPYCSEAHVTKFN
GAYSADRYFPNLDEMEGWKLVCVGEPKEFNDIRYNRLKYVNENPKVY
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctattgttgcggttgattctaactggggaattggatataaagggaatctgctt
caacgtattcccgaggatatgagatttttcaggcagatgactttgaataaagttgtggta
atgggaaggaagacgtttgaatcgttgcccggaaaagaacctttaaaggatagggtaaat
ataatattaagtaagagtgaaaacattgaaaaagacggaataataatatgtcgttccgtt
gacgggctttttttggagcttaaaaaatataactccgatgatatttttgtaataggcgga
gaagaggtatacacacagctgttgccatattgctccgaggctcatgttaccaaatttaac
ggtgcgtattctgcagacagatattttcccaacctcgatgaaatggaagggtggaaactg
gtttgtgtgggcgagccgaaggagtttaacgatatccggtataaccgcttgaaatatgta
aacgaaaatcccaaagtatactga

DBGET integrated database retrieval system