KEGG   Ruminiclostridium thermocellum ATCC 27405: Cthe_1261Help
Entry
Cthe_1261         CDS       T00474                                 

Definition
(RefSeq) 6-phosphofructokinase (EC:2.7.1.11)
  KO
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cth  Ruminiclostridium thermocellum ATCC 27405
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Brite
KEGG Orthology (KO) [BR:cth00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Cthe_1261
   01230 Biosynthesis of amino acids
    Cthe_1261
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cthe_1261
   00030 Pentose phosphate pathway
    Cthe_1261
   00051 Fructose and mannose metabolism
    Cthe_1261
   00052 Galactose metabolism
    Cthe_1261
  Energy metabolism
   00680 Methane metabolism
    Cthe_1261
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Cthe_1261
Enzymes [BR:cth01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Cthe_1261
Protein phosphatases and associated proteins [BR:cth01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Cthe_1261
Messenger RNA biogenesis [BR:cth03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Cthe_1261
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1530841..1531815)
Genome map
AA seq 324 aa AA seqDB search
MSSVRTIGVLTSGGDAPGMNAAIRSVVRTGLYYGFKVLGIRKGFNGLINGDIEELTARSV
GDIIHRGGTILQTARSPQFKTEEGLKKAMSMAKVFGIDALVVIGGDGSYRGARDISKLGL
NVIGIPGTIDNDIGCTDYTIGFDTAMNTVQDAIDKIRDTAYSHERCSVLEVMGRHAGYIA
VNVSISGGAEAVVLPEKPFDMDTDVIKPIIEGRNRGKKHYLVIVAEGGEGKAIEIAKEIT
EKTGIEARATILGHIQRGGSPTVYDRVMASQMGAKAVEVLMENKRNRVIVFKDNQIGDMD
LEEALQVKKTISEDLIQLSKILAL
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgagcagtgtaagaacgattggagttttgacaagcggtggagacgctcccggaatgaat
gcggccataaggtcggttgtgagaacaggactgtattatggctttaaggttttgggaata
agaaagggttttaacggtcttataaacggagatattgaagaactgacggcaagatcagtg
ggagatataattcacaggggaggtaccattctccagacagccagatcaccccagtttaag
accgaggaaggacttaaaaaagccatgtccatggcaaaagtatttggtattgacgctctt
gtggtaataggcggtgacggttcttacagaggagcaagagacatcagcaaacttggactt
aatgtcataggaatacccgggacgattgataatgacattggttgcaccgattataccata
ggttttgataccgccatgaacactgtccaggatgcgatagacaagatacgcgatactgca
tattcccatgaaagatgcagtgtgctggaagttatgggaagacatgccggatatattgct
gtgaatgtaagtatttccggaggtgctgaggctgtcgttctgcctgagaaaccttttgat
atggataccgatgtcataaagcccataattgagggaaggaacagaggcaaaaagcactac
cttgttatagttgccgaagggggagaaggcaaagccatcgagatcgcgaaagagattacg
gaaaagacgggtattgaagccagagccaccatactgggtcatatacaaaggggaggcagt
cccactgtatacgacagagtaatggcaagtcagatgggagcgaaggctgttgaagttttg
atggaaaacaagcgtaacagagtaattgtctttaaggacaaccagataggtgatatggat
ttggaagaagctttgcaggttaaaaagaccatttcggaagatttgattcagcttagcaaa
atattagcattataa

DBGET integrated database retrieval system