KEGG   Clostridium thermocellum ATCC 27405: Cthe_1315Help
Entry
Cthe_1315         CDS       T00474                                 

Gene name
gmk
Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
cth  Clostridium thermocellum ATCC 27405
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:cth00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1598719..1599330)
Genome map
AA seq 203 aa AA seqDB search
MYREGLLVVVSGPSGAGKGTLLNLLKDSGDNNIRFSVSATTRAPRVGEVDGVNYFFKTKE
EFMLMIENDELFEWVEYCDNFYGTPKKYIEDTIKGGYDCLLEIEVEGAAKVMKAYPECVS
VFILPPSFEELRRRIEKRGTEDVEVVNKRLERAKKEIAYASNYDYIIVNDNLKDAVEGLR
SIIKAEKLKLKRNRDVLCQFEHN
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgtaccgtgaagggctgctggttgtcgtatccggtccgtcaggagccggaaagggcacg
cttttgaatttgctgaaggattccggagacaacaacataaggttttcggtttctgccacc
acaagagcaccgagagtgggcgaggtggatggcgtaaactatttttttaagaccaaagaa
gaatttatgcttatgattgaaaatgacgagctttttgaatgggtggagtactgtgacaac
ttttacggaactccgaagaagtacattgaggataccataaaaggtggctatgactgtttg
ctggaaatcgaagtggaaggagcggcaaaagtaatgaaagcctatcctgaatgtgtttcg
gtttttattttgccgccttcttttgaagagttgagaagaagaattgaaaaaagaggcact
gaggatgttgaggtggtgaataagcgccttgagagggcaaaaaaagaaattgcctatgct
tcaaactacgattacatcatagttaacgacaatcttaaagatgcagtggaaggtttgcgc
agcataatcaaggcagaaaagctgaagctcaagcgaaacagggatgtgctttgtcagttt
gaacacaactga

DBGET integrated database retrieval system