KEGG   Ruminiclostridium thermocellum ATCC 27405: Cthe_1381Help
Entry
Cthe_1381         CDS       T00474                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
cth  Ruminiclostridium thermocellum ATCC 27405
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cth00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Cthe_1381
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Cthe_1381
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Cthe_1381
Enzymes [BR:cth01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Cthe_1381
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1685147..1686646)
Genome map
AA seq 499 aa AA seqDB search
MYYESTRGGLKSVSSAEAIKRGIAPDGGLFVPENKVSFTGSEISAMADMSYQERALYILK
HYLTDYSDEEIADCVYNAYTDEKFDDKRIAPLVQLNENVNILELWHGPTCAFKDMALQIL
PHFLVKAVRKTGETGEIVILVATSGDTGKAALEGFKDVEGTRIIVFYPQDGVSQVQKMQM
VTQEGKNVYTIGVEGNFDDAQSGVKAIFTDEELKQKMDKGNFKFSSANSINWGRLVPQIV
YYFSAYADMLKNGEIKEGDKINFVVPTGNFGNILAAFYAMQMGLPVNRLICASNDNNVLT
DFINTGVYDKNREFKRTISPSMDILISSNLERLLFELTGHDPLPVNNWMSSLKETGKYTV
DNTMKKKISEIFWGGYSNEAETLKTIEAIYKEYGYVIDTHTAVGVDVYDKYVISTGDVTK
TVIASTASPFKFNESVVKAVLGNEALKGRTEFELLEVLAKECRLKIPEGLKDLDKKPVLH
KQVCSKFDMKQQVESILGL
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgtattatgaaagtacacgagggggattaaaatctgtatcatctgctgaagctataaaa
aggggtatagcgccggacggtggattgtttgtcccggagaataaagtaagttttaccggt
agtgaaattagcgccatggctgatatgagttatcaggaaagggcgttatatatattaaag
cactatcttacggattatagcgatgaagaaatagcggactgtgtttacaatgcctatacc
gatgaaaagttcgacgacaaaagaattgctcccttggttcagctgaatgaaaatgtcaat
atcctggaattgtggcacggaccaacatgtgcattcaaagacatggcacttcaaatattg
cctcatttccttgtaaaggcagtgagaaaaaccggcgaaaccggtgaaatcgtaattttg
gttgcaacttcaggagataccggaaaagctgctttggaaggttttaaggatgttgagggc
acaagaataattgtgttctatccccaggatggcgtaagccaggttcagaaaatgcaaatg
gtcacccaggaaggaaaaaatgtttacaccataggagtggaaggaaattttgacgacgca
caaagcggagtaaaagcaatttttaccgatgaagaacttaagcagaaaatggacaaaggc
aatttcaaattttcatcggcgaattccattaactgggggagacttgtacctcagatagtc
tattatttttcggcatatgctgatatgctgaagaacggtgaaataaaagagggagacaag
attaactttgttgtccccacaggaaatttcggaaatattcttgcggctttctatgcaatg
caaatggggcttcctgtaaacaggctcatttgtgcgtccaatgacaataatgttttaacc
gattttatcaatacaggagtatatgacaaaaacagggagtttaagaggaccatttcgccg
tctatggacatattgatttcaagcaaccttgaaagactcctctttgaacttaccggacat
gatcctttgccggtgaacaattggatgagcagtttgaaagaaaccggaaaatatactgtt
gacaatacaatgaagaaaaagatatcggaaatattctggggcggatattcaaacgaggct
gaaactttaaagacgatagaggctatatacaaggaatacggatatgtcattgatacccat
actgctgtaggtgttgatgtgtatgacaaatatgtaatttccaccggtgacgtgacaaag
acggtcattgcgtcaacggcaagtcctttcaaatttaatgaaagtgtggtaaaagcagtt
ttgggaaatgaagcgttaaaaggaaggacggaatttgaacttcttgaggttttggcaaaa
gagtgcaggcttaaaataccggaaggtttgaaagatcttgacaaaaagcctgtgcttcac
aaacaggtttgcagtaaatttgatatgaaacagcaggttgaaagtattcttggtctgtaa

DBGET integrated database retrieval system