KEGG   Ruminiclostridium thermocellum ATCC 27405: Cthe_1411Help
Entry
Cthe_1411         CDS       T00474                                 

Definition
tryptophan synthase, alpha chain (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
cth  Ruminiclostridium thermocellum ATCC 27405
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cth00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Cthe_1411
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Cthe_1411
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Cthe_1411
Enzymes [BR:cth01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Cthe_1411
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1729879..1730649)
Genome map
AA seq 256 aa AA seqDB search
MNKLERAFSNGKAFIPFITAGDPSLEITEQLVYRMAEAGADLIELGIPFSDPVAEGPVIQ
EADYRALSAGTTTDKIFDMVGRIRKSCDIPIAFMTYANPIFTYGSEKFLKRCGETGIDAL
IVPDIPFEEKEELAPFCKEYDVRFISMIAPTSKERIRMIAREAEGFIYCVSSMGVTGVRE
KIGDDAKEMIKIVKEVRDIPCAVGFGISTPEQAAQMAGFSDGVIVGSAIVKIIAQYGAEC
IPYVEEYVRKMKNAIK
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgaataaattagaacgggcgtttagcaacggaaaggcatttattccgttcattacggcg
ggcgatccgtcactggagataaccgaacagttggtgtatagaatggctgaagccggggcg
gatttaattgagctcggcataccgttttccgatccggtggcggagggacctgttattcag
gaggcagattaccgtgccctttcggcgggtactacaacggacaagatttttgacatggtg
ggacgcatacgtaaatcctgcgatatacctattgcttttatgacatatgccaatccgata
tttacttacggaagtgaaaagtttttgaaaagatgcggcgaaacaggaattgatgccctt
attgttcccgatattccttttgaggaaaaggaagaactggctcctttctgcaaagaatat
gatgtcagatttatctcaatgatagcacccacgtcaaaagagcgcatcagaatgattgcc
agggaagcggaaggctttatttactgtgtgtcgtccatgggtgttaccggtgtcagagag
aaaatcggtgatgatgccaaagaaatgataaaaattgtaaaagaggtcagagacattccg
tgtgccgttggatttggtatttccactccggagcaggctgctcagatggccggtttctcc
gacggagtgattgtaggaagtgcaattgtaaagattatagcccaatacggtgccgaatgc
ataccgtacgttgaagaatatgtgcgtaaaatgaaaaacgcaataaaataa

DBGET integrated database retrieval system