KEGG   Ruminiclostridium thermocellum ATCC 27405: Cthe_1435Help
Entry
Cthe_1435         CDS       T00474                                 

Definition
(GenBank) Phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
cth  Ruminiclostridium thermocellum ATCC 27405
Pathway
cth00010  Glycolysis / Gluconeogenesis
cth00260  Glycine, serine and threonine metabolism
cth00680  Methane metabolism
cth01100  Metabolic pathways
cth01110  Biosynthesis of secondary metabolites
cth01120  Microbial metabolism in diverse environments
cth01130  Biosynthesis of antibiotics
cth01200  Carbon metabolism
cth01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cth00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cthe_1435
  Energy metabolism
   00680 Methane metabolism
    Cthe_1435
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Cthe_1435
Enzymes [BR:cth01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Cthe_1435
Membrane trafficking [BR:cth04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    Cthe_1435
Exosome [BR:cth04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Cthe_1435
  Exosomal proteins of melanoma cells
   Cthe_1435
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ABN52666
JGI: Cthe_1435
UniProt: A3DFD7
Position
complement(1756273..1756854)
Genome map
AA seq 193 aa AA seqDB search
MTNVYFVRHAEPDYNVRDDFARPLTKKGKEDAKLVSSYLSDKDIHVVISSPYLRAIDTVK
DFAGEVGLDIKIVDDFRERKVGNVWIEDFNSFAKKQWEDFDYKLSDGESLREVQNRNIKA
LNEVLRMYEGKNIVIGTHGTALSTIINYYDSTYGYDDFERMKLIMPWIVKMQVKKDRCIN
ITKIDILNGGRSL
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgacaaatgtatactttgtgaggcatgcggaaccggattacaatgtccgggatgatttt
gccagaccgttgactaaaaagggtaaagaagatgccaaattggtttcgtcgtatttaagc
gacaaagatattcatgtggtaatatcaagcccgtatttgcgggcaattgatacggtgaag
gattttgccggtgaagttggacttgatataaaaattgttgacgattttagagaacgaaaa
gtgggcaacgtttggatagaggactttaattcttttgcaaaaaagcaatgggaagatttt
gattacaagctgtcggacggagagagtttgagagaagttcaaaatcggaatataaaagca
ctaaacgaggttttacgcatgtatgaaggaaaaaacatagtaattgggacacatgggact
gcattgagcaccataataaattactatgacagtacttacgggtatgatgattttgaacga
atgaagctgataatgccctggattgtaaaaatgcaggttaaaaaagatagatgcataaat
attacaaaaatagacattttaaacggagggcgctctttataa

DBGET integrated database retrieval system