KEGG   Ruminiclostridium thermocellum ATCC 27405: Cthe_1472Help
Entry
Cthe_1472         CDS       T00474                                 

Definition
(GenBank) glycoside hydrolase family 5
  KO
K01179  endoglucanase [EC:3.2.1.4]
Organism
cth  Ruminiclostridium thermocellum ATCC 27405
Pathway
cth00500  Starch and sucrose metabolism
cth01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cth00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Cthe_1472
Enzymes [BR:cth01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Cthe_1472
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CBM_11 Cellulase Dockerin_1 Glyco_hydro_26 CIA30 AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: ABN52701
JGI: Cthe_1472
UniProt: P16218
Structure
PDB: 

Jmol
Position
1789679..1792381
Genome map
AA seq 900 aa AA seqDB search
MKKRLLVSFLVLSIIVGLLSFQSLGNYNSGLKIGAWVGTQPSESAIKSFQELQGRKLDIV
HQFINWSTDFSWVRPYADAVYNNGSILMITWEPWEYNTVDIKNGKADAYITRMAQDMKAY
GKEIWLRPLHEANGDWYPWAIGYSSRVNTNETYIAAFRHIVDIFRANGATNVKWVFNVNC
DNVGNGTSYLGHYPGDNYVDYTSIDGYNWGTTQSWGSQWQSFDQVFSRAYQALASINKPI
IIAEFASAEIGGNKARWITEAYNSIRTSYNKVIAAVWFHENKETDWRINSSPEALAAYRE
AIGAGSSNPTPTPTWTSTPPSSSPKAVDPFEMVRKMGMGTNLGNTLEAPYEGSWSKSAME
YYFDDFKAAGYKNVRIPVRWDNHTMRTYPYTIDKAFLDRVEQVVDWSLSRGFVTIINSHH
DDWIKEDYNGNIERFEKIWEQIAERFKNKSENLLFEIMNEPFGNITDEQIDDMNSRILKI
IRKTNPTRIVIIGGGYWNSYNTLVNIKIPDDPYLIGTFHYYDPYEFTHKWRGTWGTQEDM
DTVVRVFDFVKSWSDRNNIPVYFGEFAVMAYADRTSRVKWYDFISDAALERGFACSVWDN
GVFGSLDNDMAIYNRDTRTFDTEILNALFNPGTYPSYSPKPSPTPRPTKPPVTPAVGEKM
LDDFEGVLNWGSYSGEGAKVSTKIVSGKTGNGMEVSYTGTTDGYWGTVYSLPDGDWSKWL
KISFDIKSVDGSANEIRFMIAEKSINGVGDGEHWVYSITPDSSWKTIEIPFSSFRRRLDY
QPPGQDMSGTLDLDNIDSIHFMYANNKSGKFVVDNIKLIGATSDPTPSIKHGDLNFDNAV
NSTDLLMLKRYILKSLELGTSEQEEKFKKAADLNRDNKVDSTDLTILKRYLLKAISEIPI
NT seq 2703 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaaggcttttagtttcttttttggtgttaagcataattgtaggattactttct
tttcagtcgcttggtaattacaacagtggtttaaaaatcggtgcttgggtgggaacccag
ccgtcagaatcagcaattaagagttttcaggaacttcagggtagaaagcttgatattgtc
caccagtttattaactggtcaactgatttttcctgggtaagaccttatgccgacgctgtt
tataataacggctcaatattaatgattacctgggaaccttgggaatacaacactgtagat
atcaaaaacggtaaagcggatgcttacataaccagaatggcgcaagatatgaaagcctat
ggcaaggaaatttggttaagacctcttcatgaagccaacggagactggtatccatgggcc
ataggatattcttcaagagtaaacacaaacgaaacttacatagccgctttcagacatatt
gtcgatattttccgtgccaacggagccaccaacgtcaaatgggtgtttaatgtaaactgc
gacaatgtaggtaacggcacaagttatctgggtcattatcccggagataattatgtagac
tacacctcaattgacggatacaactggggtaccactcaaagctggggaagccaatggcaa
agctttgatcaggttttctccagagcctaccaagctttggcatcaataaacaaacccatc
attatagcagagtttgcatcagctgaaataggcggaaacaaggcaagatggattacagaa
gcatataactctataagaacatcctacaacaaggtaattgctgcagtatggtttcacgag
aacaaagaaaccgactggagaatcaactcaagtcctgaagcccttgcagcatacagggag
gcaataggagccggttcatcaaatcctacccctactccaacttggacctctactccacca
tcaagctcaccaaaggctgtcgacccctttgaaatggttagaaaaatgggtatgggaaca
aacctcggaaacactctcgaagctccctatgaaggctcctggtccaagtctgccatggaa
tattattttgatgattttaaagctgcaggatataaaaacgtaagaatccctgtaagatgg
gacaaccatacaatgaggacatacccgtataccattgacaaagcctttttggacagggtt
gagcaagtggttgactggtcactttcaagaggttttgttacaattataaattctcaccat
gatgactggatcaaggaagactataacggaaacatagaacggtttgaaaagatatgggaa
cagattgcggaaaggtttaaaaacaaatccgaaaatcttctgtttgaaatcatgaatgag
cctttcggtaacattacagacgaacaaatagacgacatgaacagcagaatattaaaaata
atcagaaagaccaatccaacccgtattgttataataggcggaggttattggaacagttat
aatacgcttgtaaacattaaaattcctgatgacccatacttaatcggaactttccattac
tatgacccatatgaatttactcacaagtggagaggtacatggggtactcaggaagacatg
gatactgtagtaagagtatttgattttgttaagagttggtctgacagaaacaatatcccg
gtatattttggagaatttgccgtaatggcttatgccgacagaacttcccgtgtaaaatgg
tatgattttataagtgatgcggccctggagcgcggttttgcatgttccgtatgggataac
ggcgtttttggttcattggataatgacatggctatttacaacagagatacccgtaccttt
gacactgaaatcctcaatgcactatttaatcccggaacatatccgtcttattctccgaaa
ccttcaccaactccaagaccgaccaaaccgcccgtaacaccggctgtcggtgaaaaaatg
ctggatgattttgagggtgtgttaaattggggttcatactccggtgaaggtgcaaaagtt
tcaacaaaaattgtgtccggaaaaacaggaaacggcatggaagtcagctacaccgggaca
acggacggctactggggaacagtatacagtttaccggacggcgattggtcaaaatggctt
aaaatctcttttgacattaagtccgttgacggttctgccaatgaaatcagatttatgatt
gctgaaaaaagcataaacggtgtgggagacggagaacactgggtttactcaataactccc
gacagttcgtggaaaactatagaaataccgttctccagctttagaagaagacttgattat
cagccgcctggacaggatatgagcggtactttggatcttgacaatatagattcaattcac
ttcatgtatgccaacaacaagtcgggaaaatttgtcgtagacaatatcaagctgattggt
gctacttccgatccgactccttcaataaaacacggagatttgaacttcgataatgcagtg
aattctacagacttgttaatgcttaaaaggtatatcctcaaatctttggaactcggtaca
tctgagcaggaggaaaaattcaaaaaagcggcagatttaaacagggacaacaaggtcgac
tccactgacttgacaattttgaaaagatacttgctgaaagccatcagtgaaatacccata
taa

DBGET integrated database retrieval system