KEGG   Ruminiclostridium thermocellum ATCC 27405: Cthe_1838Help
Entry
Cthe_1838         CDS       T00474                                 

Definition
glycoside hydrolase family protein
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
cth  Ruminiclostridium thermocellum ATCC 27405
Brite
Enzymes [BR:cth01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     Cthe_1838
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2181190..2183049)
Genome map
AA seq 619 aa AA seqDB search
MLKKKLLTLLTVFALLTVGICGSFLPLPKASAAALIYDDFETGLNGWGPRGPETVELTTE
EAYSGRYSLKVSGRTSTWNGPMVDKTDVLTLGESYKLGVYVKFVGDSYSNEQRFSLQLQY
NDGAGDVYQNIKTATVYKGTWTLLEGQLTVPSHAKDVKIYVETEFKNSPSPQDLMDFYID
DFTATPANLPEIEKDIPSLKDVFAGYFKVGGAATVAELAPKPAKELFLKHYNSLTFGNEL
KPESVLDYDATIAYMEANGGDQVNPQITLRAARPLLEFAKEHNIPVRGHTLVWHSQTPDW
FFRENYSQDENAPWASKEVMLQRLENYIKNLMEALATEYPTVKFYAWDVVNEAVDPNTSD
GMRTPGSNNKNPGSSLWMQTVGRDFIVKAFEYARKYAPADCKLFYNDYNEYEDRKCDFII
EILTELKAKGLVDGMGMQSHWVMDYPSISMFEKSIRRYAALGLEIQLTELDIRNPDNSQW
ALERQANRYKELVTKLVDLKKEGINITALVFWGITDATSWLGGYPLLFDAEYKAKPAFYA
IVNSVPPLPTEPPVQVIPGDVNGDGRVNSSDLTLMKRYLLKSISDFPTPEGKIAADLNED
GKVNSTDLLALKKLVLREL
NT seq 1860 nt NT seq  +upstreamnt  +downstreamnt
atgctgaagaaaaaactgttgacccttttgacagtctttgctctgctgactgtcggtatc
tgcggaagttttttgccgttacccaaagcatccgcagcagctctgatttacgatgatttt
gaaacaggtctgaacggatggggaccaagaggaccggaaaccgtcgaacttaccaccgag
gaagcttactcgggaagatacagtttgaaggtcagcggacgtaccagcacatggaacggg
cccatggttgacaaaaccgatgtgttgactttgggcgaaagctataagttgggcgtatat
gtaaaattcgtgggtgattcctattcaaatgagcaaagattcagtttgcagcttcaatat
aacgacggagcaggagatgtataccaaaatataaaaaccgccacggtttacaagggaaca
tggactttgctggaaggacagcttacagttcccagccatgcaaaggacgtaaaaatatat
gtggaaaccgaatttaaaaattctccgagtccgcaggacttgatggatttctatattgac
gatttcacagcaacacctgcaaatttgcctgaaattgagaaagatattccaagcttgaaa
gatgtctttgccggttatttcaaagtgggtggtgccgcaactgtggcggaactggcgccg
aagcctgcaaaagagcttttcctcaagcattataacagcttgacttttggtaatgagtta
aaaccggaaagtgtacttgactatgatgctacaattgcttatatggaggcaaacggaggc
gaccaggttaatccgcagataaccttgagagcggcaagacccctgttggagtttgcgaaa
gaacacaacatacctgtaagaggacatacccttgtatggcacagccagacaccggactgg
ttcttcagagaaaattactctcaggacgaaaatgctccctgggcatccaaggaagtaatg
ctgcaaaggttggaaaactacataaagaatttaatggaagctttggcgaccgaatatccg
acggttaagttctatgcatgggacgttgtgaatgaggctgttgatcctaatacttcagac
ggtatgagaactccgggttcgaataacaaaaatcccggaagctccctgtggatgcaaacc
gttggaagagattttattgttaaagcttttgaatatgcaagaaaatatgctcctgcggat
tgtaaactcttctacaatgactataatgaatatgaagacagaaaatgtgattttattatt
gaaattcttaccgaacttaaagccaaaggcctggttgacggtatgggtatgcaatcccac
tgggttatggattatccaagcataagcatgtttgaaaaatccatcagaagatatgcagca
ttgggattggaaattcagcttaccgagctggatataagaaatcctgacaacagccagtgg
gctttggaacgtcaggctaatcgttataaggagcttgtaacaaaattggtcgatttgaaa
aaagaaggcataaacattacggcattggtattctggggaataaccgacgcgacaagctgg
cttggaggatatccgctcctgtttgacgcggaatacaaggcaaaacctgcattttatgct
atagttaacagcgttccgccgcttccgacagaaccgccggttcaggttatacccggtgat
gtaaacggtgacggtcgtgtaaattcatccgacttgactcttatgaaaagatacctttta
aaatccataagcgacttcccgacaccggaaggaaaaattgcggcggatttaaacgaagac
ggcaaggtaaactcgacagatttgttagcgctgaaaaaactcgttctgagagaactttga

DBGET integrated database retrieval system