KEGG   Ruminiclostridium thermocellum ATCC 27405: Cthe_2142Help
Entry
Cthe_2142         CDS       T00474                                 

Definition
(GenBank) recombination protein RecR
  KO
K06187  recombination protein RecR
Organism
cth  Ruminiclostridium thermocellum ATCC 27405
Pathway
cth03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:cth00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Cthe_2142
DNA repair and recombination proteins [BR:cth03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     Cthe_2142
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Cthe_2142
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Toprim_4 RecR Toprim HHH_5 HHH HHH_8 IMS_HHH Cdd1 DZR Poty_PP Prok-RING_4 zf-ribbon_3
Motif
Other DBs
NCBI-ProteinID: ABN53346
JGI: Cthe_2142
UniProt: A3DHB7
Position
complement(2546255..2546854)
Genome map
AA seq 199 aa AA seqDB search
MSFYAAPIARLIEEFEKLPGIGHKTAQRLAFYVLDMPQEKVDRLANAITEAKQKTKFCSV
CGNLTDTDVCPLCSSEKRDSSVICVVEDPRDVVAMEKIREFKGLYHVLHGAISPMQGIGP
EDIKIKELLDRIKEGNVKEVIIATNPNIEGEATAMYISKLIKPLGVKTTRIAHGIPVGGD
LEYADEVTLAKALEGRREI
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgagcttttatgccgcaccgattgcaaggcttatagaggagtttgagaagctccccggc
atagggcacaagactgcccagcgattggctttttatgtgctggatatgccccaggaaaaa
gttgataggcttgcaaacgctataactgaagcaaagcagaaaacaaaattttgttcggta
tgtggcaatttaaccgatactgatgtttgtccgctttgcagttcggaaaaaagggatagt
tctgtaatttgcgtcgttgaagaccccagggatgttgttgcaatggagaaaatacgggag
tttaaagggctttatcacgtgctgcacggtgcgatatcacccatgcaggggattggacct
gaggatataaaaatcaaggagcttttagacaggataaaggaaggaaacgtcaaagaggtc
attattgcaacaaatcccaatattgaaggtgaagcaactgcaatgtatatttcaaagctt
attaagcctttgggtgttaagactacaagaatagctcatggaatacctgtcggcggagat
cttgaatatgctgatgaagttacattggcaaaggctttggagggaaggcgcgagatttag

DBGET integrated database retrieval system