KEGG   Clostridium thermocellum ATCC 27405: Cthe_2191Help
Entry
Cthe_2191         CDS       T00474                                 

Definition
1,4-alpha-glucan branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
cth  Clostridium thermocellum ATCC 27405
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:cth00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2610189..2612402
Genome map
AA seq 737 aa AA seqDB search
MNTTANIDEVYKVINAEHHDPFSVLGMHRLESENAMVVRAYLPNAKEIEVVELSKNNTYP
MEKIDERGFFEVVIKDRNDFFKYNLRATDYVGNTFTFYDPYCFMPVISDYDLYLFNEGNH
HKIYEKLGTHRMTIDGVEGTLFAVWAPCAKRVSVVGNFNQWDGRRHQMRVRGSSGVWELF
IPGVGEGELYKYEIKTPHNEIYIKADPYAFYSELRPNTASIVYDIEGYEWHDADWMRERD
SSNSFDKPISIYEVHLGSWKRVSNDENGFYSYRELADMLVEYVKYMGYTHIELLPIAEHP
FDGSWGYQVTGYYAATSRYGQPKDFMYFVDKCHQNGIGVIIDWVPAHFPKDGHGLARFDG
TALYEHYDPKQGEHPDWGTHIFNYGRNEVKNFLIANAMFWFDKYHIDGLRVDAVASMLYL
DYGKKDGEWIPNRWGGKENVDAIEFMRQLNSTVFQYFPGVMMIAEESTAWALVTKPPYTG
GLGFSYKWNMGWMNDFLRYMSMDSVYRKYHQNLITFSLMYAFSENFILVLSHDEVVHGKC
SMINKMPGDYWQKFAGLRASYGYLYGHPGKKLLFMGGEFAQFIEWNYKQSLDWFLLDYDM
HKKMQDYVRDLNKLYRSEKALYEVDFHYDGFEWIDCNDTEHSIISFMRKGKDWHNSLIFV
CNFTPVPHEDYRIGSPFNTTYDEIFNSDWEKYGGSNVGNFEPIKAEEISMHNKPYSMRLR
IPPLATIVLKPRFDRKD
NT seq 2214 nt NT seq  +upstreamnt  +downstreamnt
atgaacacaacagcaaatattgacgaggtttacaaggttatcaatgcagagcatcatgat
ccgttcagtgtgctgggaatgcaccgtctggaatctgagaatgcaatggtcgtaagggca
tatctgccaaatgcaaaagaaatagaagtagtggaactctccaaaaacaacacataccca
atggagaaaatcgacgagaggggcttttttgaggttgtaataaaagacaggaatgacttt
ttcaagtataacctgagggccaccgactacgtaggcaacacttttaccttttacgaccct
tactgtttcatgcccgtgatctctgactatgacctttatttattcaatgagggcaaccat
cataaaatctacgaaaagcttggtacccacagaatgactattgacggtgttgaaggcaca
ctttttgccgtttgggccccctgtgcaaaacgcgtaagtgttgtgggaaatttcaaccag
tgggacggccgcaggcaccaaatgagagtgagaggaagttccggagtatgggagttgttt
attccgggtgttggtgaaggcgagctttacaaatatgaaataaagacacctcacaacgaa
atttacatcaaagccgacccctatgctttttattcggaacttcggccaaatacagcttcc
atcgtgtatgatattgaaggatatgaatggcatgacgcagactggatgcgtgaaagagac
agcagcaattcctttgacaagcccatatccatatacgaagtgcatcttggctcatggaaa
agagtctccaacgatgaaaacggcttttactcatacagggaacttgcagatatgctggta
gagtatgtgaaatacatgggttacacccatattgaacttctgccgattgcagaacatcct
tttgacggttcgtggggataccaggttacaggatattatgcagcaaccagcagatacgga
cagccaaaagattttatgtattttgtggacaaatgccaccaaaacggcataggagttata
atcgactgggtaccggctcattttcccaaagacggccacggtctggcaagatttgacggc
acagccctgtatgagcattacgaccccaaacaaggcgagcatcctgactggggaactcat
atattcaattacggaagaaatgaagttaaaaacttcttaattgccaatgccatgttctgg
ttcgataaataccatattgacggacttagggttgacgcagtggcatccatgctctatctg
gattacggcaaaaaggacggggaatggatacccaatcgctggggaggaaaagaaaacgtc
gacgccattgagtttatgaggcagctgaattcaaccgtgttccaatacttccccggtgtt
atgatgatcgctgaggaatccacagcctgggctttagtaaccaaacctccttacacaggt
ggtcttggcttctcgtacaaatggaacatgggctggatgaacgactttttgcgctatatg
agtatggactcggtatacagaaagtaccatcaaaatcttataaccttctccctgatgtac
gctttctcggaaaactttatacttgtactctcccatgacgaagtagtacacggcaaatgc
tccatgataaacaaaatgccgggagattactggcaaaagtttgcgggcctgcgtgcaagc
tacggttacctgtacggccatcccggcaagaaacttcttttcatggggggagaatttgca
cagtttattgaatggaactacaagcaaagccttgactggttcctgctggattatgacatg
cataagaaaatgcaggattatgtacgggacctcaacaagctttacagaagcgaaaaagca
ctgtatgaagttgatttccattatgatggctttgaatggatagattgcaacgatacggaa
cacagcattatttcctttatgagaaagggcaaggactggcataattctctcatatttgtg
tgcaacttcactcccgtgccccatgaagactaccgcattggttcgccttttaacaccact
tatgatgagattttcaacagcgactgggaaaaatacggcggaagcaatgtcggaaacttc
gagcctattaaggctgaagagataagcatgcacaacaaaccttattccatgaggcttcgc
attccgccgcttgcaacaattgtgctaaagccaaggtttgacaggaaggattaa

DBGET integrated database retrieval system