KEGG   Ruminiclostridium thermocellum ATCC 27405: Cthe_2249Help
Entry
Cthe_2249         CDS       T00474                                 

Definition
ATP-dependent RecD/TraA family DNA helicase (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
cth  Ruminiclostridium thermocellum ATCC 27405
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:cth00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Cthe_2249
Enzymes [BR:cth01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Cthe_2249
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2675408..2677648)
Genome map
AA seq 746 aa AA seqDB search
MDNLVTIEGTVEEIIFSNEANGYTVCEIKCDKEVITVVGYMPFINVGETLRVSGKWVIHP
DYGEQLKVELYEKLLPETPEAIERYLASGLIKGVGPATAKKIVKKFADQTLHIISHHPQR
LAEIKGITMEKALRIGQAFEEQRGLRDVVLFLQEYGISPTYCAKIYKTFGPDTIEEIRKN
PYRLSDEIFGISFRTADRIAKSLGIDPYSKYRISSGIKYVLSRAATEGHTFLEEEMLKSY
TSKLLDINIDSIEDALVSLVLNKSVYVDRNDGMSKIYLSSFYHAELGVCRKLVELSQVRY
SADMEDFEERIKQVQKKEGIILADKQKEAIREAMTNGVLVITGGPGTGKTTIIKSIISLL
ESEGYEFALAAPTGRAAKRMSEATGYEAKTIHRLLEIGYTSNEDELVFMRTEDNPIEADV
VIIDEMSMVDIILMYHLLKAIVCGTRLILVGDVDQLPSVGPGNVLRDIIKSGMIKTVKLS
EIFRQAGESMIVVNAHRINRGEHPILNEREKDFFFVTRNSQNDILKTVVDLCTRRIPDTY
GYDPMKQIQVLSPMRKGTVGVANLNIELQKVLNPEDGKKKQKAFRNYVFREGDRVMQIKN
NYNLRWEKINGPGQEGAGVFNGDMGIIVEIDDEEQKIKVLFDDEKLVEYDYTILDELEPA
YAVTIHKSQGSEFPVVILPVFPGPSVLMTRNLLYTAITRARELVILVGNKDCLYGMIMND
RETKRNSDLAEKLRKCIVGVDWLKQW
NT seq 2241 nt NT seq  +upstreamnt  +downstreamnt
gtggataatttggtaactattgaaggtactgttgaagaaattatattctccaatgaagcc
aatggatataccgtttgtgagataaaatgcgataaagaagttattaccgtcgtgggatat
atgccttttatcaatgtgggtgagacgctgagagtttcggggaagtgggtcatccaccct
gactatggcgagcagctcaaagtggagctgtatgaaaagctgcttccggaaacgccggag
gctatagaaaggtatcttgcgtcagggcttatcaagggagtcggccctgcaaccgcaaaa
aagattgtaaagaaattcgcagaccaaactcttcatattataagtcatcacccgcagagg
cttgccgagataaaaggtattaccatggaaaaggctttgagaataggacaggcctttgag
gagcaaagaggccttcgggatgttgtgctgtttctgcaggagtatggcataagtccgact
tattgtgccaaaatatacaagactttcggaccggataccatagaagaaatcaggaaaaac
ccttaccggctttcagacgagattttcggaataagtttcagaacggctgaccggatagcc
aaaagccttggaatagacccttactcaaaatacaggatttcaagcggtatcaaatatgtg
ttaagccgggccgcgacagaaggtcatacttttttggaagaagagatgctaaaaagttat
acgtcaaaacttttggacatcaacattgacagcattgaagacgctctcgtttcccttgtg
ctgaataagtcggtgtatgtggacagaaatgacgggatgtcaaagatatatttgagttca
ttttaccatgcggagctgggagtatgcagaaagctggtggaactttcccaggtaaggtat
agcgccgatatggaggactttgaggaaaggataaagcaggttcagaaaaaagagggtata
atacttgcggacaagcaaaaggaagccatcagggaagcaatgactaacggcgtgcttgtc
ataaccggagggccgggcacaggcaagacaaccataatcaaaagcattataagccttctt
gaaagtgaaggatatgagtttgcccttgcagctcccaccggcagggcggcaaagaggatg
tccgaggctacgggctatgaggcaaaaaccattcacaggctccttgagattggttatacc
tcaaatgaggacgagcttgtgtttatgaggacggaagacaatcccatagaggctgatgtg
gtgataattgacgagatgtccatggtggatataattctcatgtaccacctgcttaaagct
attgtctgcggaacaaggcttatactggtcggagatgtggatcagcttccttcggtgggg
ccgggaaatgtcctcagggatataataaaaagtgggatgatcaagaccgtaaagttgtct
gaaatattccggcaggccggagagagtatgatagttgtcaatgcccacaggataaaccgc
ggagagcatcctatattaaatgagagggaaaaagattttttctttgtgacaagaaattcc
cagaatgatattttaaaaaccgtggttgatctttgtacaagaagaatacccgatacttac
ggatatgatcccatgaaacagatacaggtattgtcgcctatgagaaagggtacggtggga
gtggcaaacctcaatattgagcttcagaaggttttaaatcccgaagacggaaaaaagaaa
caaaaagccttcagaaactatgtattccgtgagggagaccgggtgatgcagataaaaaac
aactacaacctcagatgggaaaaaatcaacggcccgggccaggaaggagcgggtgtgttt
aacggcgatatgggaattatagttgaaatagatgatgaagagcaaaaaataaaggttttg
tttgacgatgaaaagcttgtggaatatgattacactattttggacgagcttgagccggcc
tatgccgttaccattcacaaaagccagggaagtgagtttcccgtggtgatacttccggtg
tttcccgggccttcggtgcttatgaccagaaatcttttgtacactgcgataacaagggcg
agggagctggtgatactggtgggcaataaagattgtctttacgggatgattatgaacgat
cgggagaccaaaagaaactcggatttggctgaaaaacttagaaaatgcatagtgggagtg
gactggttgaaacaatggtaa

DBGET integrated database retrieval system