KEGG   Ruminiclostridium thermocellum ATCC 27405: Cthe_2391Help
Entry
Cthe_2391         CDS       T00474                                 

Definition
(GenBank) pyruvate ferredoxin/flavodoxin oxidoreductase, delta subunit
  KO
K00171  pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1]
Organism
cth  Ruminiclostridium thermocellum ATCC 27405
Pathway
cth00010  Glycolysis / Gluconeogenesis
cth00020  Citrate cycle (TCA cycle)
cth00620  Pyruvate metabolism
cth00633  Nitrotoluene degradation
cth00640  Propanoate metabolism
cth00650  Butanoate metabolism
cth00680  Methane metabolism
cth01100  Metabolic pathways
cth01120  Microbial metabolism in diverse environments
cth01130  Biosynthesis of antibiotics
cth01200  Carbon metabolism
Module
cth_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:cth00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cthe_2391
   00020 Citrate cycle (TCA cycle)
    Cthe_2391
   00620 Pyruvate metabolism
    Cthe_2391
   00640 Propanoate metabolism
    Cthe_2391
   00650 Butanoate metabolism
    Cthe_2391
  Energy metabolism
   00680 Methane metabolism
    Cthe_2391
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Cthe_2391
Enzymes [BR:cth01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Cthe_2391
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4 Fer4_7 Fer4_6 Fer4_2 Fer4_21 Fer4_10 Fer4_9 Fer4_16 Fer4_13 Fer4_17 Fer4_3 Fer4_15
Motif
Other DBs
NCBI-ProteinID: ABN53593
JGI: Cthe_2391
UniProt: A3DI14
Position
2856685..2856990
Genome map
AA seq 101 aa AA seqDB search
MSKELRDVKPDVTWKEITSGGVIDSPGNAHLFKTGDWRSMKPVWNEEKCKQCLLCNPVCP
DSSIMVSEEGKMTGIDYDHCKGCGICSKVCPFKAIDFVEEV
NT seq 306 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaagaattgagagatgtaaaacctgatgttacctggaaagagataacatccggt
ggagtgatagattcccctggaaacgcacatctttttaagaccggtgactggcgttctatg
aagccggtgtggaatgaggagaaatgcaagcagtgtttgctttgcaacccggtatgtcct
gattcatccataatggtaagtgaagagggaaaaatgacaggtatcgattatgatcactgc
aaaggatgtggcatttgttcaaaggtttgtcctttcaaagccatagactttgtagaggaa
gtataa

DBGET integrated database retrieval system