KEGG   Ruminiclostridium thermocellum ATCC 27405: Cthe_2392Help
Entry
Cthe_2392         CDS       T00474                                 

Definition
(GenBank) pyruvate flavodoxin/ferredoxin oxidoreductase domain protein
  KO
K00169  
pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
cth  Ruminiclostridium thermocellum ATCC 27405
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:cth00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Cthe_2392
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cthe_2392
   00020 Citrate cycle (TCA cycle)
    Cthe_2392
   00620 Pyruvate metabolism
    Cthe_2392
   00640 Propanoate metabolism
    Cthe_2392
   00650 Butanoate metabolism
    Cthe_2392
  Energy metabolism
   00680 Methane metabolism
    Cthe_2392
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Cthe_2392
Enzymes [BR:cth01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Cthe_2392
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2857007..2858191
Genome map
AA seq 394 aa AA seqDB search
MGIRERLSGNEATAIAMRQINPDVVAAFPITPSTEIPQYFSSYVADGLVDTEFVAVESEH
SAMSACIGAQAAGARAMTATSANGLAYMWEALYIAASMRLPIVLAAVNRALSGPINIHND
HSDTMGARDSGWIQLYSENNQEAYDNMLMAHRIGEHPDVMLPVMVCQDGFITSHAIENIE
LVEDEKVKAFVGEYKPTHYLLDRENPISVGPLDLQMHYFEHKRQQAQAMENAKKVILEVA
EEFYKLTGRKYGFFEEYKTDDADVAIVVMNSTAGTVKYVIDEYRAKGKKVGLIKPRVFRP
FPVDELAQALSKFKAVAVMDKADSFNAAGGPLFTEVTSALFTKGVFGPKVINYKFGLGGR
DVKVDDIEVVCEKLLEIASTGKVDSVYNYLGVRE
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgggaataagagaaaggcttagcggtaatgaggcaacggcgattgccatgagacaaata
aatcctgatgtggttgctgcttttccgataacaccgtcaacggaaattcctcaatatttc
tcgtcatatgtcgctgacggacttgtagatacggaatttgttgctgtggaatcagagcac
agtgcaatgtctgcatgtataggtgctcaggctgcaggtgcaagagcaatgactgccaca
tccgcaaacggtttggcatatatgtgggaggctttgtatatagcggcaagtatgagactt
ccgattgtattggcggctgtaaacagagcactttcaggtcctatcaatatccacaacgac
cacagcgatacaatgggagctagggattcgggatggatccagttatacagtgaaaacaac
caggaggcttatgacaacatgcttatggctcacaggataggtgagcatcctgatgtaatg
cttcctgtcatggtctgccaggacggatttattacttctcacgcaatagaaaatattgaa
ctggtggaagatgagaaagttaaggcttttgtaggagaatacaaaccgactcattatctt
ctcgacagggaaaatccgatttctgtgggtcctttggatttgcagatgcattatttcgag
cacaagagacagcaggcacaggcaatggaaaacgccaaaaaggtaattcttgaagtggcg
gaagaattctacaagcttacgggaagaaaatacggattttttgaagaatacaaaaccgat
gatgccgatgttgccattgttgttatgaactccactgccggtactgtaaaatatgttatc
gacgagtacagggcaaaaggcaaaaaagttggtttgataaaacctagagtattcagacct
ttccctgttgatgaactggcacaggctttgtcaaagtttaaggcagtggccgttatggac
aaggctgacagcttcaatgcagccggaggacctttgtttacagaggtaacaagtgcactc
ttcacaaaaggagtatttggtcctaaggttattaactataagtttggattgggtggaaga
gacgttaaagttgatgatattgaagttgtttgtgagaagcttctggaaattgcaagtaca
ggcaaggtagactcagtatacaattaccttggtgttagagagtag

DBGET integrated database retrieval system