KEGG   Ruminiclostridium thermocellum ATCC 27405: Cthe_2393Help
Entry
Cthe_2393         CDS       T00474                                 

Definition
(GenBank) thiamine pyrophosphate TPP-binding domain-containing protein
  KO
K00170  
pyruvate ferredoxin oxidoreductase beta subunit [EC:1.2.7.1]
Organism
cth  Ruminiclostridium thermocellum ATCC 27405
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:cth00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Cthe_2393
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cthe_2393
   00020 Citrate cycle (TCA cycle)
    Cthe_2393
   00620 Pyruvate metabolism
    Cthe_2393
   00640 Propanoate metabolism
    Cthe_2393
   00650 Butanoate metabolism
    Cthe_2393
  Energy metabolism
   00680 Methane metabolism
    Cthe_2393
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Cthe_2393
Enzymes [BR:cth01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Cthe_2393
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2858204..2859139
Genome map
AA seq 311 aa AA seqDB search
MAYNLKEVAKKPERLTGGHRMCAGCGAPIVVRQVLKALKPEDHAVISAATGCLEVSTFIY
PYTAWKDSFIHSAFENTGATISGAEAAYKVLKKKGKIEGETKFIAFGGDGGTYDIGLQAL
SGAMERGHDMVYVCYDNGAYMNTGIQRSSATPKYADTTTSPVGKKIPGKMQPRKDLTEVL
VNHRIPYVAQTAPFGNMKDLYEKAEKAIYTPGPAFLNVLAPCPRGWRYNTPDLMELSKLA
VETCFWPLYEVIDGKYIINYKPKEKVPVKEFLKLQGRFKHLFKAGNEYMLEEIQKEVDLR
WERLLKLAGEA
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atggcttataatttgaaagaagttgcaaaaaaaccggaaagacttacgggcggacacaga
atgtgtgcaggctgcggagctccgatagttgtaagacaggttcttaaggcattaaaaccg
gaagatcatgcggttatctcagctgcaacaggttgtttggaagtttcaactttcatttac
ccttatacagcatggaaggattctttcattcacagtgcgtttgaaaataccggtgctaca
atttccggtgcggaagcggcttataaagtattgaagaaaaaaggaaaaattgaaggggag
accaagtttattgcgttcggtggtgacggcggaacatacgacataggacttcaggcactc
tcaggagcgatggaaagaggacacgacatggtttatgtgtgctacgacaatggagcatac
atgaacacaggtatccagaggtcttctgccactccgaaatacgctgataccacaacttca
cctgttggaaagaagatacccggtaaaatgcagccaagaaaagacctgacagaagtattg
gtaaatcatcgcataccttatgttgctcaaaccgctcctttcgggaacatgaaggacctc
tatgaaaaagctgaaaaagctatttatacacccggtcctgcgttcctgaacgtgttggca
ccgtgcccgagaggatggagatacaacactcctgatttgatggaattgagcaaattggcg
gttgaaacttgcttctggccgctttatgaagtaattgacggcaaatatataataaactac
aagccgaaggaaaaagttcccgtcaaggaattcttgaaacttcagggaagatttaaacat
cttttcaaagccggcaacgaatatatgctggaagaaattcagaaagaagtcgacttaaga
tgggagagactcttgaagctggccggagaggcttaa

DBGET integrated database retrieval system