KEGG   Ruminiclostridium thermocellum ATCC 27405: Cthe_2442Help
Entry
Cthe_2442         CDS       T00474                                 

Definition
carbohydrate kinase FGGY
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
cth  Ruminiclostridium thermocellum ATCC 27405
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cth00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Cthe_2442
Enzymes [BR:cth01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Cthe_2442
Exosome [BR:cth04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Cthe_2442
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2912358..2913842
Genome map
AA seq 494 aa AA seqDB search
MNNFYVLSIDQSTQGTKAVILNDSGIIQARHDLPHKQIINENGWVSHDPEEIYENVIKTV
KMVVEKAGIDKNRILCVGISNQRETTVVWDKKTGKPLCNAIVWQCNRAKDICERIKKAGY
ENCIAAKSGLKLSPYYPAGKMTWFMENVPDVDKKADDGDAAFGTIDSWLVYKLTKGKSYK
TDYSNASRTQLLNLTTLKWDEQLCDIFGIPVKALPEICDSNSVFGETDFEGYLEKPIPIC
GVLGDSHGALFGHNCRKEGSIKVTYGTGSSVMLNTGNIPIFSKHGLSTSLAWVIDGKASY
VLEGNINYTGAVISWLKDALGLIQSAKETAELSKRANPNDGTYLVPAFTGLGAPYWKSEA
KAIIAGMSRSTGKAELVKAANESIAYQINDVILAMRKDTGLEISELCVDGGPTRDDYLMQ
FQSDISDADIKIPNIEELSATGAAFLAGMSANLYDDTVYNAISYRFYHSKMNSQVRNEKV
DGWKAAVNMLLSKE
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgaataatttttacgttctcagcatagatcagagcactcaagggactaaagcggttatt
ctaaacgactctggaattattcaagcaagacatgatctcccacataagcaaatcataaat
gaaaatggatgggtttcccatgatccggaagaaatctatgaaaatgtaattaagaccgtg
aaaatggtagtggaaaaagcaggcatagataaaaaccggattctttgcgtgggaatttca
aaccagagagagacaacagtcgtatgggacaagaaaacaggcaagcctctttgcaatgca
attgtttggcaatgcaacagagcaaaagatatttgtgaaagaataaaaaaggcgggatac
gagaattgtatagccgcaaaatcgggtttaaagctttctccgtattatccggccggtaag
atgacatggtttatggagaatgttccggatgtagacaaaaaagcagatgacggagatgcg
gcttttggaacaatagatagctggcttgtttataaactgacaaagggaaaaagttataaa
accgattattcaaatgccagtcgtacccagcttttaaatttaaccacactgaagtgggat
gaacaactctgcgacatatttggaataccggttaaagcacttcctgagatttgtgattca
aattcagtgtttggcgaaactgattttgaaggttatcttgaaaagcccattccaatctgc
ggggtacttggggattcccatggtgcgttgtttggacacaactgcagaaaagaaggttcg
ataaaagttacttatggaacaggctcatccgttatgctaaacacgggcaacataccgatt
ttcagcaaacatggattatccacctctcttgcctgggtaatcgacggaaaagcttcttat
gttctcgaaggcaatattaactataccggtgcggttatttcatggcttaaagatgctctt
ggattgattcagtctgcgaaagaaacggctgagttgtcaaaaagggcaaacccaaatgat
ggaacttatttggttcccgcatttaccggtttgggggctccgtactggaaaagcgaagcc
aaggcgatcattgccggaatgagccgttcgaccggcaaagcagagctggtgaaagcggct
aatgaatctattgcttatcaaattaatgatgttattttggcaatgcgaaaagatacgggg
ttggaaatttcggaattgtgtgttgacggaggaccgaccagggatgattatctgatgcag
ttccagagcgatatttctgatgcagatattaaaatacccaatattgaggagctttctgca
acaggagcggcttttctggccggaatgtcagccaatctgtatgatgacaccgtgtataat
gccatatcatatcgattttaccattccaaaatgaattctcaagtacgcaatgaaaaagtt
gatggttggaaagcagcagtaaatatgcttttaagcaaggagtga

DBGET integrated database retrieval system