KEGG   Clostridium thermocellum ATCC 27405: Cthe_2528Help
Entry
Cthe_2528         CDS       T00474                                 

Definition
uroporphyrinogen-III synthase / uroporphyrinogen-III C-methyltransferase (EC:4.2.1.75 2.1.1.107)
Orthology
K13542  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
cth  Clostridium thermocellum ATCC 27405
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:cth00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2996125..2997606
Genome map
AA seq 493 aa AA seqDB search
MADGKGKVYLVGAGPGDEELLTVKAADVIKKADVIVYDRLISDGILSKIPDNAEKIYVGK
NAGNHPVPQHEINKILLAKALEAKIVVRLKGGDPFVFGRGGEELEFLHQNGIPFEVVPGI
TSAIAAAAYAGIPVTHRDFCSSLHIITGHVKDGGNPDIDYESLVKLKGTLIFMMSVASFP
QIAQGLIEAGMESDMDAAVIENGTMPNQRKFVSKLCDIPKVIAENQVKSPAIIIVGKVCS
LSEKLDWFSKLPLYGCNVLVTGPKKTSERLAGKLRGLGAHVVEYPCIETEPLDFDIDIRE
HSWIIFTSSLGVTIFFKKLYENKLDSRYLYNKKIAAVGSQTAEELLKHGICADFVPGKFD
GRHLAEELLQSGKISPEDKVVIFRAKDGTQAIVDIFENNNIHYTDISVYETKCIENERID
ISGFNYITFTSESCVKGFAHSFKNTIDYSKINAICIGEQTAKATRAYGMNTIISDVATVS
SMVEKIIEMHCAK
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atggctgacggcaaaggaaaggtttacctggtgggagcgggaccgggagatgaggaactt
cttactgttaaggcagccgatgttataaaaaaggcggatgtcatagtttatgacagactt
ataagcgatggtattctttcaaaaattcccgacaatgcggagaaaatctatgttggaaaa
aatgccggcaatcatccggttcctcagcatgaaataaataaaatccttctggccaaagca
ctggaagctaaaattgttgttaggcttaaaggcggcgatccctttgtatttggcagaggg
ggagaggagctggagttcttgcatcaaaacggcataccttttgaggtagtgccgggcatt
acttcggcaatagccgcagcagcatatgcaggcattcctgtcacccatagagatttttgc
tcgtcgctgcatattataaccggacatgtaaaagacggcggaaatccggacatcgactat
gaatctttagtgaagctaaaaggaactctcatctttatgatgtcggtggcctcatttccg
caaatagcacagggccttatagaagccggcatggaatccgatatggatgcggcagtgata
gaaaacggcacaatgccaaaccaaagaaaatttgtttcaaagctttgtgacatcccgaaa
gttatcgcagaaaatcaggttaaatcccctgcaataatcatagtcggaaaggtatgttcc
ctttctgaaaagcttgattggttttcaaaattgcctctttacggatgcaatgtattggta
acaggcccaaagaaaacatcggagagattggcaggcaaactccgagggctcggagcacat
gtagttgaatatccttgcatagaaacagaaccactcgactttgacattgatatacgagag
catagctggataattttcacaagcagcctgggtgtaacaatattctttaaaaaactgtat
gaaaacaagcttgacagcagatatttgtacaataaaaaaattgcagcggtaggctcccag
accgccgaagaactgttaaaacacggaatatgcgccgactttgttcccggtaaatttgac
ggcagacatttagcggaagagcttttgcaaagcggcaaaataagccctgaagacaaagtg
gttattttcagggcaaaggacggaacccaggccattgtagatattttcgaaaacaataat
atacactacactgatatctctgtatatgaaactaaatgcatagaaaatgagagaattgac
ataagtggttttaattatattacttttaccagcgaaagctgcgtaaaaggctttgcccac
tcctttaaaaacacaatagattattcaaaaatcaatgcaatatgcattggagaacaaaca
gccaaagctacaagggcttatggaatgaacacaattatttccgatgttgcaacggtttct
tcaatggttgaaaaaattattgaaatgcattgcgctaaataa

DBGET integrated database retrieval system