KEGG   Clostridium thermocellum ATCC 27405: Cthe_2581Help
Entry
Cthe_2581         CDS       T00474                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
cth  Clostridium thermocellum ATCC 27405
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cth00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3054052..3055233
Genome map
AA seq 393 aa AA seqDB search
MINARIVYINDMHEAKEEIRKIGVDASAITWLSPKALSIAIKLENVSSYEANILKQEMLA
KGGDAAVNRGVANFSTESSDVLLMGTYSQFNKLVYKLRMHGGSFKEITDEIQRLLEGLEK
GKPEYFECGKYRLPIGEKTYVMGILNVTPDSFSDGGKYLDIDSAVKRAREMVDEGADIID
VGGESTRPGHQPVDALEEINRVIPVIERLSKELNVPISVDTSKAQVAEKALCAGACIVND
VWGLQRDPDMAEVVSKHGAGVIMMHNSDTKEYKDLMGDIIRFLRKSVEIAEKAGITRENM
VIDPGIGFGKTLEHNLEVMRRMRELNTLNLPVLLGTSRKSMIGNVLDLPVNERLEGTAAT
ITLGIANGADIVRVHDVKEMVRVARMTDAMVRV
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgataaacgcaagaattgtctacataaatgatatgcatgaagcaaaagaagaaatccgc
aaaatcggtgtggatgcgtcagccataacatggctttcacccaaagcattgtccattgca
ataaagcttgagaatgtaagctcttatgaggcaaacatactcaagcaggaaatgctggcc
aagggcggagatgccgccgtaaacagaggtgtggcaaatttcagcacggaaagctccgat
gttctcctgatgggcacatacagccagtttaacaaacttgtgtacaagcttcgcatgcac
ggcggaagtttcaaggaaattaccgatgaaatccaaaggcttctggaaggtttggagaag
ggaaagccggagtattttgaatgcggcaagtatagactgcccataggagaaaaaacttat
gtgatgggaatactcaatgttacaccggattctttctccgacggtggaaaatatcttgat
attgacagtgcggtaaaaagagccagggaaatggtggatgaaggcgctgacataatagat
gtgggaggagagtcgacgaggcccgggcatcagcccgttgatgccctggaggaaataaac
cgggtgataccggttatagaaaggctttcaaaggagttgaatgtgcccatatcggttgac
accagcaaggctcaggttgcagaaaaggctctttgtgcgggtgcctgcattgtaaatgac
gtttggggcctccagagggacccggacatggcggaggttgtatcaaagcacggtgcagga
gtaattatgatgcacaacagtgacaccaaagaatacaaggacctaatgggtgacattata
aggtttttgagaaagagtgttgaaatagccgaaaaggccggaattaccagggaaaatatg
gttattgaccccggaataggctttggaaagactttggagcacaacctggaagtaatgaga
agaatgagggaactaaacaccctaaaccttccggttcttcttgggacatcaagaaagtcc
atgataggaaatgttttggatttgcctgtaaatgaaaggcttgaagggactgccgcaacc
attacccttggtattgccaacggggcggatatagtgagagtccacgatgtaaaggaaatg
gtgcgggtggcaaggatgaccgatgctatggtaagagtttga

DBGET integrated database retrieval system