KEGG   Ruminiclostridium thermocellum ATCC 27405: Cthe_2796Help
Entry
Cthe_2796         CDS       T00474                                 

Definition
pyruvate ferredoxin oxidoreductase subunit alpha (EC:1.2.7.1)
Orthology
K00169  
pyruvate ferredoxin oxidoreductase, alpha subunit [EC:1.2.7.1]
Organism
cth  Ruminiclostridium thermocellum ATCC 27405
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:cth00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Cthe_2796
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cthe_2796
   00020 Citrate cycle (TCA cycle)
    Cthe_2796
   00620 Pyruvate metabolism
    Cthe_2796
   00640 Propanoate metabolism
    Cthe_2796
   00650 Butanoate metabolism
    Cthe_2796
  Energy metabolism
   00680 Methane metabolism
    Cthe_2796
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Cthe_2796
Enzymes [BR:cth01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Cthe_2796
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3295743..3296930
Genome map
AA seq 395 aa AA seqDB search
MGDKAFLSGNEAVAEGVRLASPHVIAAYPITPQTVVVERLAEMVEDGRLKAEFLHVESEH
SALSACMGAASIGARTFTATSSQGLLYMAECLHYASGGRFPIVMMNANRSLALPWSIYGD
HRDSLSQLDCGWIQIYVEDAQESLDMVIQAYKIAENPKVLTPVMINLDGFVLTHTYEPVD
IPLKEEVDKFLPPFETPYKMDLKNPKNMGFSSSPSDNTEFKYLQHKAILDAKEVIKEVDS
SFKKAFGRNYGGLVDAYLCEDAEFIMISLGSTTGTCRAVVDELRREGFKAGVLKIRFMRP
FPEEEIVEITKNAKAVGVIDRDISFGYEGTVFTNVNSALLKAGVDVKSVNFIAGLGGRDI
SKESIREAFHDLREVALGTLKKWFKFLSLGVSIDE
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgggagataaagcgtttctttcgggaaatgaagcagtggcggaaggagtgcggcttgca
agtccccatgtgattgccgcttatccgattactccccagacggttgtggtggagcggttg
gcggaaatggtggaggacggaaggcttaaagcggaattccttcatgtggagtccgaacat
tcggccctgtctgcatgcatgggagccgccagtattggggcaagaacttttacggcaact
tcatcccaggggcttttgtatatggctgaatgccttcattatgccagcggagggagattc
cccattgtaatgatgaatgccaaccgttcccttgcgctaccgtggagtatatacggcgat
cacagggattccttgtcgcagctggactgcggctggatacagatatatgtggaggacgcc
caggaaagcctggatatggtgattcaggcttataaaatagcggaaaatccaaaggtgctt
acaccggtcatgataaatctcgacggatttgtgcttacccacacttatgagccggtggat
attcctttgaaagaagaagtggataagtttctgccgccttttgaaaccccatacaaaatg
gatttgaaaaatcccaagaacatgggttttagttcttcgccttcagacaacacggagttc
aaatacctgcagcacaaggccatattggatgcgaaagaggtaataaaagaagtggacagt
tccttcaaaaaagctttcggaagaaactatggaggtcttgttgacgcatacttgtgcgag
gacgcggagtttatcatgataagccttggcagcaccacaggaacgtgcagagcggtggtg
gatgagctaaggcgggaaggatttaaagcaggagtgctgaaaatacgtttcatgcggccg
tttcctgaagaggaaatagtagaaattactaagaatgcaaaggctgtgggagtgatagac
agggatatatcttttggatatgagggaacggtctttaccaatgtcaactccgctctttta
aaggcaggggtggatgtgaagagcgtaaactttatagccgggcttggaggacgggatatt
tccaaagaaagcatacgggaggcattccatgatttgagggaagttgctctgggcacttta
aagaagtggtttaagtttttgagtctgggggtatctatagatgagtaa

DBGET integrated database retrieval system