KEGG   Clostridium thermocellum ATCC 27405: Cthe_2796Help
Entry
Cthe_2796         CDS       T00474                                 

Definition
pyruvate ferredoxin oxidoreductase subunit alpha (EC:1.2.7.1)
Orthology
K00169  
pyruvate ferredoxin oxidoreductase, alpha subunit [EC:1.2.7.1]
Organism
cth  Clostridium thermocellum ATCC 27405
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Pyruvate:ferredoxin oxidoreductase
Class
Metabolism; Overview; Carbon metabolism [PATH:cth01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:cth00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:cth00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:cth00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:cth00640]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:cth00650]
Metabolism; Energy metabolism; Methane metabolism [PATH:cth00680]
Metabolism; Xenobiotics biodegradation and metabolism; Nitrotoluene degradation [PATH:cth00633]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3295743..3296930
Genome map
AA seq 395 aa AA seqDB search
MGDKAFLSGNEAVAEGVRLASPHVIAAYPITPQTVVVERLAEMVEDGRLKAEFLHVESEH
SALSACMGAASIGARTFTATSSQGLLYMAECLHYASGGRFPIVMMNANRSLALPWSIYGD
HRDSLSQLDCGWIQIYVEDAQESLDMVIQAYKIAENPKVLTPVMINLDGFVLTHTYEPVD
IPLKEEVDKFLPPFETPYKMDLKNPKNMGFSSSPSDNTEFKYLQHKAILDAKEVIKEVDS
SFKKAFGRNYGGLVDAYLCEDAEFIMISLGSTTGTCRAVVDELRREGFKAGVLKIRFMRP
FPEEEIVEITKNAKAVGVIDRDISFGYEGTVFTNVNSALLKAGVDVKSVNFIAGLGGRDI
SKESIREAFHDLREVALGTLKKWFKFLSLGVSIDE
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgggagataaagcgtttctttcgggaaatgaagcagtggcggaaggagtgcggcttgca
agtccccatgtgattgccgcttatccgattactccccagacggttgtggtggagcggttg
gcggaaatggtggaggacggaaggcttaaagcggaattccttcatgtggagtccgaacat
tcggccctgtctgcatgcatgggagccgccagtattggggcaagaacttttacggcaact
tcatcccaggggcttttgtatatggctgaatgccttcattatgccagcggagggagattc
cccattgtaatgatgaatgccaaccgttcccttgcgctaccgtggagtatatacggcgat
cacagggattccttgtcgcagctggactgcggctggatacagatatatgtggaggacgcc
caggaaagcctggatatggtgattcaggcttataaaatagcggaaaatccaaaggtgctt
acaccggtcatgataaatctcgacggatttgtgcttacccacacttatgagccggtggat
attcctttgaaagaagaagtggataagtttctgccgccttttgaaaccccatacaaaatg
gatttgaaaaatcccaagaacatgggttttagttcttcgccttcagacaacacggagttc
aaatacctgcagcacaaggccatattggatgcgaaagaggtaataaaagaagtggacagt
tccttcaaaaaagctttcggaagaaactatggaggtcttgttgacgcatacttgtgcgag
gacgcggagtttatcatgataagccttggcagcaccacaggaacgtgcagagcggtggtg
gatgagctaaggcgggaaggatttaaagcaggagtgctgaaaatacgtttcatgcggccg
tttcctgaagaggaaatagtagaaattactaagaatgcaaaggctgtgggagtgatagac
agggatatatcttttggatatgagggaacggtctttaccaatgtcaactccgctctttta
aaggcaggggtggatgtgaagagcgtaaactttatagccgggcttggaggacgggatatt
tccaaagaaagcatacgggaggcattccatgatttgagggaagttgctctgggcacttta
aagaagtggtttaagtttttgagtctgggggtatctatagatgagtaa

DBGET integrated database retrieval system