KEGG   Ruminiclostridium thermocellum ATCC 27405: Cthe_2938Help
Entry
Cthe_2938         CDS       T00474                                 

Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
cth  Ruminiclostridium thermocellum ATCC 27405
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cth00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Cthe_2938
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cthe_2938
   00052 Galactose metabolism
    Cthe_2938
   00500 Starch and sucrose metabolism
    Cthe_2938
   00520 Amino sugar and nucleotide sugar metabolism
    Cthe_2938
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Cthe_2938
   00524 Butirosin and neomycin biosynthesis
    Cthe_2938
Enzymes [BR:cth01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Cthe_2938
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3453351..3454304
Genome map
AA seq 317 aa AA seqDB search
MYYIGIDLGGTNIAVGLVNEEGKILHKDSVPTLRERPYQEIIKDMAMLTLKVIKDADVSI
DQVKSIGVGSPGTPNCKDGILIYNNNLNFRNVPIRSEIQKYIDLPVYLDNDANCAALAES
VAGAAKGANTSVTITLGTGIGGGVVIDGKIYSGFNYAGGELGHTVLMMDGEPCTCGRKGC
WEAYASATALIRQARKAAEANPDSLINKLVGGDLSKIDAKIPFDAAKQGDKTGEMVVQQY
IRYIAEGLINMINIFMPEVLVIGGGVCKEGEYLLKPLRELIKQGVYSKEDIPQTELRTAQ
MGNDAGIIGAAMLGKEC
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgtattacatagggattgatcttggcggtacgaatatcgccgtgggtttggtaaatgag
gaaggaaaaatacttcacaaggacagcgttcccacgctgagggaaagaccgtatcaggaa
ataatcaaagacatggcaatgcttaccttaaaagtaataaaggatgcagatgtcagcatt
gaccaggttaaaagcattggggtcggaagtcccggaaccccgaactgcaaggatggaatt
cttatctataacaataacttgaatttcagaaatgttccgataaggtctgaaatacaaaaa
tatattgatttgcccgtataccttgacaatgacgcaaactgtgcggcacttgccgaaagt
gtggcaggggcggcaaaaggcgcaaacacatccgtaaccataaccttgggtacgggaata
ggcggaggagtcgtaatagacggcaaaatatacagcggtttcaactatgcgggaggagaa
ctggggcatactgttttgatgatggacggtgagccttgcacctgcggaagaaaaggctgc
tgggaagcatatgcgtcggcaacggctcttataaggcaggccagaaaggcggccgaggca
aatcccgattcacttataaacaagcttgtgggaggggatttgtcaaaaattgatgcaaaa
attccttttgatgcggcaaagcagggagacaaaaccggcgagatggtggtgcagcaatat
ataagatatattgccgaaggccttatcaacatgataaatatatttatgcctgaggtactg
gtgataggtggaggagtatgcaaagaaggagaataccttttaaagcctctgagggaactt
ataaaacagggagtttacagtaaagaggatatacctcaaactgagctgagaacggcccaa
atgggcaatgacgccggaataatcggtgccgcaatgctggggaaagaatgttag

DBGET integrated database retrieval system