KEGG   Ruminiclostridium thermocellum ATCC 27405: Cthe_2949Help
Entry
Cthe_2949         CDS       T00474                                 

Definition
pectinesterase
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
cth  Ruminiclostridium thermocellum ATCC 27405
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cth00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Cthe_2949
   00500 Starch and sucrose metabolism
    Cthe_2949
Enzymes [BR:cth01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     Cthe_2949
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3466795..3468498)
Genome map
AA seq 567 aa AA seqDB search
MIKNKKILLLLCINLCLFFLLINRIQLVSSAAVNADIIVAKDGTGNFTTIQAAIDSVPSN
SSKRTVIFVKNGTYKEVVTIRKNNIHLIGESNTKTIITYDNYAGKLKPDGTTYGTSGSAS
FYLYGTDTILENITIENSFDESIDVKDKQAVAAYIRGDRQIIKNCIFIGNQDTLYAHSGR
QYYVNCKIIGDTDFIFGGATAVFENCEIVSTPKGGYVTAASTDLENYGFLFLNCRLTSDA
PKNSTYLGRPWRPNAYVVYKTCYLGAHIKESGWTSMSGNLPENARFFEYKNTGPGAVVNS
SRRQLSYAEAAKFTPQNLLKGTDNWNPVALVSQTSTLTPTQKPTSTPAPTPMDGQLIKSL
TVKDSANSSNWSIQSNLRVGDTVFGDRTYKFVTIPNEFLGSEWIRTACDSKKSTEDLAYF
TAKADITVYVGLDSRVATIPSWLNDWTKTSLTITDDGSPQVTYNLYKKNFSANSVVTLGP
NGASSGAVNYIVIVKQNNQNIVYGDLNGDGLVNSSDYSLLKRYILKQIDLTEEKLKAADL
NRNGSVDSVDYSILKRFLLKTITQLPV
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atgataaaaaacaaaaaaatattacttttactatgcattaatctttgcctgttcttttta
ctaatcaatagaattcagcttgtgtcttccgcagcggtcaatgcggatataatagttgcc
aaagacggtacaggcaatttcacaaccatacaggccgcaattgattcagtaccgtcaaac
agttcaaaaagaaccgttatatttgtcaaaaacggtacatacaaagaagttgttacaatc
aggaaaaacaacatacacctcatcggagaaagcaatacaaaaacaatcattacatatgac
aattatgcgggtaaactaaaacctgacggcaccacatacggtacatccggttccgcatca
ttctatctctatggaactgacacaatccttgaaaacatcacaattgaaaattcctttgat
gaaagtatcgacgtaaaagacaagcaagccgtagctgcttatatccgcggcgacaggcaa
ataatcaaaaattgtatttttatcggaaatcaggataccttgtatgcacactcgggcaga
cagtattatgtgaactgcaaaatcataggtgacacggattttatatttggcggcgccaca
gctgtatttgaaaactgcgaaattgtttcaacacccaaagggggatatgtcactgctgca
agcactgatctcgaaaattacggatttctgttcttaaactgcagattgacaagcgatgct
cccaaaaattcaacatatcttggaagaccctggcgtcccaatgcatatgtagtttacaaa
acatgttatttgggagcgcatataaaggagtccggctggaccagcatgagtggtaatttg
cctgaaaatgcgcgcttttttgagtacaaaaacacaggcccgggagcggtggtcaactca
tcgagaagacagttgtcatacgccgaagccgcaaaatttactccgcaaaacctattaaaa
ggtactgacaattggaatccggttgcgctcgtgtctcaaacgtcaactttaacaccgact
caaaaacccacctcaacaccggctccaaccccaatggacggccaattgataaaatcatta
acggtaaaggattcggcaaattcgtccaattggtccatacagtcgaatttacgggttggt
gatacagtttttggtgacagaacatacaagtttgtcacaattccaaatgagttccttggc
tccgaatggatcaggacagcctgtgactcgaaaaaatccacagaagacctggcctacttt
accgccaaagctgacataaccgtatatgtgggtctggactcaagggttgcaaccataccg
tcatggcttaacgattggaccaaaacctcactgacaataaccgacgacggttcaccacag
gttacctacaacctttacaaaaagaatttcagtgcaaactccgttgtaacccttggtcct
aatggggcttcaagcggggctgtgaattatattgtcatagttaaacaaaacaatcaaaat
atagtatatggtgatttgaacggagacggactggtaaactcaagcgactattcattatta
aaaagatacatacttaaacaaatagatttgacggaggaaaaacttaaggcggcagacctg
aatagaaacggctccgttgactcagtggattattccatattaaagagatttttgttgaaa
acaattacacaattgcctgtataa

DBGET integrated database retrieval system