KEGG   Chroococcidiopsis thermalis: Chro_0018Help
Entry
Chro_0018         CDS       T02360                                 

Definition
response regulator receiver protein
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
cthe  Chroococcidiopsis thermalis
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:cthe02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:cthe02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
24015..24443
Genome map
AA seq 142 aa AA seqDB search
MTPIKVLLVDDSPVAMSIFRKVLDSAPEVQVVGTAQDGAEALNLIPRVQPQVICTDLKMP
KMDGLEFIKHVMAKSPLPILVLSDAVQKQDIDNVFQVLQAGAVDVMPKPASVSTADQEEL
KRQLITKIRVLASKQVSAKPLT
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
atgaccccaattaaagttttattagtcgatgactctcccgttgctatgagcattttccgt
aaagtgcttgattctgcaccagaagtgcaggttgtaggtacagctcaagatggtgcagaa
gctttgaatttaattcctagagttcaacctcaagtaatttgtacggatttgaaaatgccc
aaaatggacggtttagaattcatcaaacatgtcatggcaaagtctccattaccaatttta
gttttgagcgatgccgtccaaaagcaagatatagacaacgtattccaagttttgcaagct
ggagccgttgatgtaatgccaaaacccgcatcagtttcaaccgcagatcaagaagaactg
aagcggcaattaattaccaaaattcgagttttggcaagcaaacaagtgagcgctaaacca
ctcacataa

DBGET integrated database retrieval system