KEGG   Chroococcidiopsis thermalis: Chro_0112Help
Entry
Chro_0112         CDS       T02360                                 

Definition
glutathione S-transferase
Orthology
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
cthe  Chroococcidiopsis thermalis
Pathway
Glutathione metabolism
Class
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:cthe00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
135164..135727
Genome map
AA seq 187 aa AA seqDB search
MLKLYGGAFSRAAIVQWYLEELEVPYEFVMLDMKAGEHLQPAYLAINPFGKVPAIVDGDV
RLWESGAILAYLADKYEKAELSLEERAQLSQWILFANATLGPGIFVEANRDREMPRLMTT
LNQILEQQSYLLGQQFSAADVAVGSLLSYIPIMLKLDLSGYPAVVGYVKRLAERPAFQKS
IGSRRGG
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgctcaagctttatggtggtgcttttagccgtgccgcgatcgttcaatggtatttggaa
gaactagaagttccctacgaatttgtcatgctggatatgaaagcaggagagcatctccag
ccagcatatcttgccattaatccctttggtaaagttccagcaattgtagacggagatgtc
cgactgtgggaatctggagcaattctcgcctatcttgccgacaaatacgaaaaagccgag
ctgtccttagaagaacgcgctcagctgagccaatggattttatttgctaatgccacactg
ggaccaggaatttttgtggaagcaaaccgcgatcgcgaaatgccgcgtctgatgactact
cttaatcaaattctagagcagcaatcttatttgctcggtcaacagtttagtgcagctgat
gtcgcggtcggctctctcttaagttacattccaatcatgttaaagctagatctgagcgga
tacccagcagttgttggctatgtcaaaagactcgccgaacgtccggcatttcaaaagtca
attggctctcgccgtggtgggtga

DBGET integrated database retrieval system