KEGG   Chroococcidiopsis thermalis: Chro_0445Help
Entry
Chro_0445         CDS       T02360                                 

Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
cthe  Chroococcidiopsis thermalis
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:cthe01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:cthe00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(493940..495283)
Genome map
AA seq 447 aa AA seqDB search
MLRIITQQAEVRAELQRICDRTHDEQVAHKEATVREVLQTVKRQGDRALIHYTEEFDQQT
LKPEDLRVSGSELDAAYQQVSQELLSAIQLACRRIEAFHRQRVPKSWVHFDEDGVVLGKR
YTPVDSAGLYVPGGRAAYPSTVLMNAIPAKVAGVKRCVIVTPPGMGKTMNPAVLVAAQEA
GIEEIYRVGGAQAIAALAYGTETLPKVDVITGPGNIYVTLAKKLVYGTVGIDSLAGPSEV
LIIADEQANPVHVAADLLAQAEHDPMAAAILLTTDASLAKQVQTEVERQLVNHPRRTLTE
KAIAHYGSIAVVDSLNTAAQLSNEFAPEHLELEVADPWALLEQIRHAGAIFLGNSTPEAV
GDYLAGPNHTLPTSGAARYASALGVETFLKHSSVIQYTPEALQKVAGAIDTLATTEGLPS
HADSVRLRMQDLQAGDWQIGTGEKDGQ
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgaatcatcactcagcaggctgaggtaagagccgaactccagcggatctgcgat
cgcacccacgacgaacaagtggctcataaggaagcgacggttcgggaggtgcttcagacc
gtgaagcgccaaggagaccgcgccttaattcactacactgaagaatttgaccaacaaacg
ctgaaaccagaagacctgcgcgtgagcggctcggaactggatgcggcttaccaacaggtg
tctcaagaattactcagcgctatccagctcgcctgtcggcggatcgaggcatttcaccgc
cagcgcgtccctaaatcttgggtacatttcgacgaggacggggtggtattaggtaagcga
tacaccccagtggatagcgcggggctgtatgtccctggagggcgagctgcctaccccagt
acggtgttgatgaacgcaattccagcaaaagtggctggggtgaagcgctgtgtcatcgtc
actccgccagggatgggaaaaaccatgaatccggcggtgctagtggcggctcaggaggca
ggaattgaagaaatttatcgcgtcgggggagcgcaggcgatcgcggctttggcatacggt
acggaaacactgccgaaagtcgatgtgattacgggacctggtaatatttacgtgacgcta
gcgaaaaaactcgtctacggtacggtgggaatcgattctttagccggaccttcggaagtc
ctaattattgccgacgaacaggctaaccccgtccacgttgctgccgacttgttagcccag
gcagaacacgacccaatggcagcggcaatattgttaacgacagatgcgagtttggctaag
caagttcaaacagaagtcgagcgccagttagtcaatcacccgcgccggacgctgacggaa
aaagcgatcgcccactatggttcgatcgcagtcgtggactcgctcaatactgcggctcaa
ctatcgaacgagtttgcccccgaacacctagaattagaagtagccgatccttgggcgctg
ttagagcagatccgccatgcaggagcgattttcttgggtaattctacccctgaagctgta
ggagactacttagccggtcccaaccacacgttacctacttctggtgctgctcgttatgct
tccgctttgggggtagaaactttcctcaaacactctagtgtgattcagtacacgccggaa
gcactccaaaaagttgcaggggcaattgataccctcgcaacaaccgaaggactgccttct
cacgctgattctgtgcggttgcgaatgcaagatttgcaggcgggagattggcaaatcgga
actggtgaaaaggatggacagtga

DBGET integrated database retrieval system