KEGG   Chroococcidiopsis thermalis: Chro_0492Help
Entry
Chro_0492         CDS       T02360                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
cthe  Chroococcidiopsis thermalis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cthe00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Chro_0492
Enzymes [BR:cthe01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Chro_0492
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(560238..561758)
Genome map
AA seq 506 aa AA seqDB search
MPTFPRAAGILLHPTSLPGRFGIGDLGLAAYRLIDFLSNSYQQLWQVLPLGPTGYGNSPY
MCYSAMAGNPLLISPEQLQENGLLSQEDFANLPEFEGDRVEYDRAIEIKIPLLRKACENF
RNNASELQQQEFAGFCRAKGYWLDDYALFMALKDALEDKSWYDWEPEIARRQPEAMEKWR
QQLDGEIFYQKFIQFEFFQQWSKLKRYANMHGIQIIGDIPIYVAHDSADVWANPEIFCLD
EETGAAALMAGVPPDYFSATGQLWGNPVYNWEALQQQHFKWWVQRFEAMLDYVDIIRIDH
FRGFESYWAVKEGETTAINGTWIEAPGVELFEAIAQQLGKLPVLAEDLGIITPEVEALRD
RFEFPGMKILQFAYGSDAANPYLPFNYPRNCVVYTGTHDNDTSVGWFNTASDYEKQRLLL
YMGCISPDGIHWDLIRLAFSTTANQAIIPLQDILGLGSEARMNVPSQAEGNWAWRYQPDV
LTQELSDRLKLYTELYGRAPQVTHGG
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgccgacttttcccagagccgctggaattttgctgcatccgacttccctacctggtcgc
tttggtattggcgacctcggtttagctgcttaccgtttgattgattttttaagcaatagt
taccagcaactctggcaggttctacccttgggacctacaggctacggtaattctccttat
atgtgctattcggcaatggcaggaaatccgttgttaattagcccagaacaattacaagaa
aatgggttgctcagtcaagaagattttgccaatttacctgagttcgagggcgatcgcgta
gaatacgatcgcgcgattgaaattaaaattcctttattgcgtaaagcctgcgagaatttt
cgcaataacgcctcagagttacagcagcaagaatttgctggtttttgtagagccaaaggc
tattggctagatgactacgccctatttatggcgctcaaagatgccttagaggataagagt
tggtacgactgggaaccagaaatcgcccgccgtcaaccggaagcaatggaaaaatggcga
cagcagttagatggcgaaattttttatcaaaaattcatccagtttgaattcttccagcag
tggtcaaaactgaagcgctatgccaacatgcacggcattcaaattattggcgatatcccc
atctacgtagcgcatgacagtgctgatgtctgggcaaaccccgaaatcttctgtctggat
gaggaaacgggtgcggcggctttgatggcgggagttccgcccgattactttagcgccacg
ggacaattgtggggcaaccccgtctataactgggaggcattgcagcaacaacacttcaaa
tggtgggtacagcgatttgaggcgatgttagattatgtcgatatcattcgcatcgaccac
tttagaggttttgagtcgtactgggcagttaaagaaggcgaaactaccgcaattaacggg
acttggattgaagcgccaggggtagagttatttgaagcgatcgcccagcagttgggtaag
ttacccgtattagctgaagacttgggaattattactccagaggtggaagcattacgcgat
cggtttgaatttccaggcatgaagattttacaatttgcctatggttccgatgctgcaaat
ccttacttacctttcaattacccccgcaactgcgtcgtctacaccggaacccacgataac
gatacgagcgtaggttggtttaacaccgcttctgactacgaaaaacagagacttttactt
tacatgggttgtattagtcctgacggtatccattgggacttaattcggctagcctttagt
actacggcaaatcaagccatcattcccttacaggatattttaggcttgggaagcgaagcg
agaatgaacgttcccagtcaagccgaggggaactgggcttggcgctatcaacccgatgtg
ttaacgcaagaattaagcgatcgcctgaagttatataccgaactgtacggacgcgccccg
caggtaactcatgggggatga

  All links  
No link information was found.   
DBGET integrated database retrieval system