KEGG   Chroococcidiopsis thermalis: Chro_0617Help
Entry
Chro_0617         CDS       T02360                                 

Definition
response regulator receiver modulated CheB methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
cthe  Chroococcidiopsis thermalis
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:cthe00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Chro_0617
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Chro_0617
Enzymes [BR:cthe01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Chro_0617
Two-component system [BR:cthe02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Chro_0617
Bacterial motility proteins [BR:cthe02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Chro_0617
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
690808..691908
Genome map
AA seq 366 aa AA seqDB search
MPKIRVLVVDDAVVVRSRLSKLLAEDPELEVVGVAANGRIALAKIAQLNPNVVILDVEMP
DMDGLATLAAIRQTYPHIAVIMFSTFTRAGAIATLDALSLGASDYATKPSHLGNIEAIRQ
HVFDDLVPKIKLFGTKQVKSQKSKVKTQESGVRSQESGASSNFSPSDPPAVFSPTPKIVA
IGVSTGGPNALAVLLSQLPADFPVPIAIVQHMPPMFTQLLAERLAAKSRLKVAEAVSGRV
LEPGQVWIAPGDFHLAVQRDGKVVRLVTHQAPPENSCRPSVDVLFSSVAEVFGASAIAIV
LTGMGQDGLRGCQQLREAGGRVLVQDEASSVVWGMPGFVANAGLANRVLPIDQMADETIR
QVCNNT
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaaatccgagttctcgtagttgacgatgcagtggttgtgcgcagccgcctgagt
aagctgctagctgaagatccagaattggaagtggtgggagtagcggcgaatggtcgcatt
gcactagcaaaaattgctcaactcaatcctaatgtggtgattttggatgtggaaatgcca
gacatggatggcttagcaactttagcagcgatccggcagacctatccccatatagctgtc
atcatgtttagcactttcacccgcgcaggggcgatcgcaactttggatgctctatctcta
ggtgcatcggattatgctaccaagccgagtcacttaggcaatatcgaagctatccgccaa
catgtttttgacgacttagtgccgaaaataaaactgttcgggacaaagcaagtcaaaagt
caaaagtcaaaagtcaaaacacaggagtcaggagtcaggagtcaggagtcaggagccagc
agtaatttttctccctcagatcccccagctgtcttctccccgactcccaaaatcgtcgcc
atcggcgtttctaccggaggaccaaacgctctagccgtgttgctatcgcaactgccagca
gattttcccgtaccaattgcgatcgtgcagcatatgccaccaatgtttactcaactgtta
gcagaacggcttgctgccaagtcccgcttaaaagtagctgaagctgtttcagggagagtg
ctggagcctggacaggtttggattgccccaggagattttcatctcgccgtgcaacgggat
ggcaaggttgtgcgcctagtcacccaccaagcgccaccagaaaactcctgccgtccctcc
gtcgatgtcttatttagctcagtcgcagaagtctttggtgcaagcgcgatcgcaattgtc
ttaacaggtatgggtcaagacggattgcggggttgccagcagctacgcgaggctgggggg
cgagttttagttcaagatgaagcgagtagcgtagtttggggaatgccggggtttgtagct
aatgccggacttgctaaccgagtgctgccgatcgaccaaatggcagatgaaacgatccgc
caagtgtgtaataatacctaa

DBGET integrated database retrieval system