KEGG   Chroococcidiopsis thermalis: Chro_0890Help
Entry
Chro_0890         CDS       T02360                                 

Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
cthe  Chroococcidiopsis thermalis
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cthe00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Chro_0890
Enzymes [BR:cthe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Chro_0890
Exosome [BR:cthe04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Chro_0890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1005582..1007096
Genome map
AA seq 504 aa AA seqDB search
MQYILGLDLGTTGNRAILFDAEGAIAGQAYKELRQYYPQPGYLEHDPEEIWQDTYTCIQQ
ILKHTGISANAIAAIGLSVQRETCLLWDKTTGKPLHKAIVWQDRRTASMCRQLQAKGQAK
TIQERTGLIVDAYFSATKFAWLLDWVRDKNININLDNILAGTIDTWILWKLTGGKVHATD
HSNASRTMLMNLAQGNWDSQLLDLFQIPDRIMPQIQPSLGMFGETDPQLLGEAIPIAAVF
GDQQAALFAHGCDRPGMVKCTYGTGCFLIAHTGEELTRSHHQLLSTVAWTQVLANGRTAT
SYALEAAMFTTGACIQWLRDGLKLIDSAAETEHLARQVTDNNGVYFVPALSGLGAPRWDM
SARGAFLGITGGVQREHMVRAVLEAIAYQVKEAIEAMNRDSSKAIEVLKVDGGACQNDFL
MQFQADALGIPIERPVVLEATAQGAAFGAGLAIGYWTDYQKLCRSRKIDRIFEPGTGAIQ
AQENFHTWLKAVNRAQHWVDESHL
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgcaatacattctaggattagatctaggcacgacagggaatcgagcaattttgttcgat
gctgaaggtgcgatcgctggtcaagcctataaagaactgaggcaatattatcctcaacct
ggctatttagaacacgatcctgaagagatttggcaagatacttacacttgtatacaacaa
attctcaaacatacaggtatttcagcaaatgcgatcgcggcaattggtttgtcggtacag
cgagaaacctgtttattgtgggataagacaacaggtaaacccttgcacaaagcaattgtc
tggcaagatcggcgtaccgcgtctatgtgtcggcaattacaagcaaaaggacaggcaaag
acaattcaagaacggactggattaattgtcgatgcctacttttcggcaactaaattcgcg
tggttgctcgattgggtacgggataaaaatataaatataaatctggataatattctggct
gggacgatcgacacttggatcttatggaaattaacgggtggcaaggttcacgctactgac
catagtaatgccagccgcacgatgttgatgaatctagcgcagggaaattgggactcgcaa
ctcctcgatttatttcagattcccgatcgcatcatgccgcaaattcagccgagtttgggt
atgtttggcgaaaccgatccgcaactactgggggaagcaattccgatcgcagcggtattt
ggcgatcaacaggcggcgctatttgctcacgggtgcgatcgtcctggtatggtgaaatgt
acgtatgggacgggatgttttttaatcgcccatacaggtgaagaactgacgcgatcgcat
caccagttattgtcaactgttgcctggacgcaagttttagcaaacggaagaacggcgacg
agttacgctttagaagcggctatgtttacgacaggtgcttgcattcagtggttgcgagat
ggtttgaagctgatcgattcagctgccgaaaccgaacacctggcgcgtcaagttacagat
aataacggtgtttacttcgtcccagcattaagtggattgggtgcgcctcggtgggatatg
agcgccaggggtgcttttctgggaattacaggcggcgtacagcgcgaacacatggtgaga
gccgttttagaagcgatcgcttatcaggtaaaagaggcgatcgaggcgatgaatcgagat
tctagcaaagcgattgaagtcttgaaagttgatggaggtgcttgtcaaaatgacttttta
atgcagttccaagccgatgcactcggaattccgatcgagcgtccagttgttttagaagca
acggctcaaggtgcagcctttggtgctggattggcgatcggttattggactgattatcaa
aaattgtgtcgcagtcggaaaatcgaccgaatttttgagccaggaacgggggcaattcaa
gcacaagaaaattttcacacttggcttaaagctgttaaccgcgctcagcattgggttgat
gaatctcatctctga

DBGET integrated database retrieval system