KEGG   Chroococcidiopsis thermalis: Chro_0948Help
Entry
Chro_0948         CDS       T02360                                 

Definition
(GenBank) Glutathione S-transferase domain protein
  KO
K11209  
GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-]
Organism
cthe  Chroococcidiopsis thermalis
Brite
Enzymes [BR:cthe01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-  
     Chro_0948
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1068562..1069260
Genome map
AA seq 232 aa AA seqDB search
MTIELYYWTTPNGHKITIFLEEAELPYEIKPVNIAKGEQFDPEFLKISPNNKIPAIIDRD
PPDGGEPISVFESGAILQYLAEKTGKFLPDNLRDRVETMQWLFWQMGGLGPMLGQNHHFV
TYAPEKIPYAIDRYVKETERLYGVLDERLTNLPFITGSYSIADMAAYPWIVPYETQQQNL
DDFPNLKRWFESIKARPAVQRAYAKADEISTAPSVTEESKAILFGQGRRRSS
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgacgatcgaactctactattggacaactccaaacggacataaaattaccatttttctt
gaggaagcagagctaccttacgaaatcaaacctgtcaatattgctaagggcgaacagttc
gacccagaatttctcaagatctcacctaacaataaaattccggcgattatcgatcgcgac
ccccctgatggtggcgaaccgataagcgtatttgaatcgggggcaattctgcaatatttg
gcagaaaaaacgggaaaatttttaccagataacctacgcgatcgcgtcgagacaatgcaa
tggctgttctggcaaatgggtggattgggtcccatgctgggacaaaatcaccactttgtc
acttacgcaccggagaaaattccttatgcgatcgatcgctacgtaaaggaaaccgaacga
ttatatggcgtactcgacgaacggctgacaaatctaccttttatcacaggtagttactcg
atcgcggatatggcagcttatccctggatcgtaccctacgagacgcaacagcaaaattta
gatgactttcccaatcttaaacgctggtttgagagcataaaagcacgtcctgccgtgcaa
cgtgcctatgctaaggctgacgaaattagtactgcgccatctgtcaccgaagaatctaaa
gcgattttattcggtcaagggcggcggcgatcgtcttaa

DBGET integrated database retrieval system