KEGG   Chroococcidiopsis thermalis: Chro_0984Help
Entry
Chro_0984         CDS       T02360                                 

Definition
(GenBank) protoporphyrin IX magnesium-chelatase
  KO
K03405  magnesium chelatase subunit I [EC:6.6.1.1]
Organism
cthe  Chroococcidiopsis thermalis
Pathway
cthe00860  Porphyrin and chlorophyll metabolism
cthe01100  Metabolic pathways
cthe01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cthe00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Chro_0984
Enzymes [BR:cthe01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Chro_0984
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mg_chelatase AAA_5 MCM AAA_22 AAA_16 Sigma54_activat AAA_29 AAA DUF815 AAA_28 ABC_tran AAA_18 AAA_30 Hpr_kinase_C SHS2_FTSA MMR_HSR1 AAA_27 RNA_helicase
Motif
Other DBs
NCBI-ProteinID: AFY86518
UniProt: K9TVU2
Position
1105024..1106148
Genome map
AA seq 374 aa AA seqDB search
MTTATAARRVVFPFTAIVGQDEMKLALLLNIIDPKIGGVMIMGDRGTGKSTTIRALADLL
PEIEVVADDPFNSHPSDPDLMGDAARQLLEQGAEIPIAKKKITMVDLPLGATEDRVCGTI
DIEKALSEGVKAFEPGLLAKANRGILYVDEVNLLDDHLVDVLLDSAASGWNTVEREGISI
RHPARFVLVGSGNPEEGELRPQLLDRFGMHAEIHTVKEPALRVQIVEQRSDFDQNPLQFS
DKYQPQQQALQQQLIKAQELLPSVQMDYDLRVKISEVCSELDVDGLRGDIVTNRAAKAIA
AFEGRTEVTVDDIRRVITLCLRHRLRKDPLEAIDSGYKVDKAFSRVFGIEPATDEMSEKT
AQANGIGQAGGRYR
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
gtgacaactgctaccgctgctcgtcgtgtcgtgtttcctttcaccgctattgtgggtcag
gacgaaatgaaactcgcccttttactcaacattattgacccgaaaattggcggggtaatg
atcatgggcgatcgcggtactggcaaatccaccacgatccgcgctttagctgacttatta
ccagagattgaagttgtagcggacgatccgttcaacagccatcctagcgatcccgatctg
atgggcgatgcagcacggcaactgttagaacaaggtgcagaaattcccatcgccaagaaa
aaaattactatggtcgatctgcccctgggagctacagaagaccgagtttgcggcacgatt
gatattgagaaagctttatctgaaggtgtcaaagcttttgaaccaggactgttggcaaag
gcaaatcgcggtatcctctacgtcgatgaagttaacctacttgacgatcaccttgtagac
gtattgctagactccgccgccagtggttggaatactgtagaacgggaaggcatttcgatc
cgtcaccccgcccgtttcgttctcgttggttctggcaacccagaagaaggtgaattgcgc
cctcaactactcgatcgcttcggaatgcacgcagaaattcatactgtaaaagaaccagcc
ttgcgggtacaaattgtggaacaaaggtcggatttcgaccaaaacccactgcaattttct
gacaaatatcagccacagcaacaagctttacaacaacagctgattaaggctcaagagttg
ttaccttcagtacaaatggattacgatctgcgggtaaaaatttctgaagtttgctccgaa
cttgatgttgatggcttgcggggtgacattgtaaccaaccgcgcagctaaagcgatcgcg
gcgtttgaaggtcgtactgaagtcacagtagatgatattcgtcgtgtcattactctatgc
ctgcgtcacagactgcggaaagaccccttagaggcgatcgattctggttacaaagtagac
aaggcatttagccgcgtgtttggcattgaaccagcgacggatgaaatgtcagaaaaaaca
gcgcaagctaatggtattggacaagcaggcggacgctatcgctag

DBGET integrated database retrieval system