KEGG   Chroococcidiopsis thermalis: Chro_1024Help
Entry
Chro_1024         CDS       T02360                                 

Definition
cytochrome-c peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
cthe  Chroococcidiopsis thermalis
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1147561..1148637
Genome map
AA seq 358 aa AA seqDB search
MNQIETLYNKNLLLMTKQVLRRIYLVALVFLATLVAIWWQRIQTPQPMREAVFERIETVQ
VDEPIQPIPLQISLDRGKVALGEQLFHEPRLSSDNKISCLSCHALNRGGADNKAFSIGVN
GKVGNINAPTVYNSAFNAYLNWNGKFATLEDFTTAVIQNPTAMGIEWQVLLPKLQRVPDY
VRAFNQNYPDGLTATNVVDAIATYLRSLYTPNSRFDRYLRGDKSAINATEKEGYRLFQAY
GCVSCHQGMNVGGNLFQKFGIMGDYFRDRGKITKVDLGRYNVTQNEADMFVFRVPSLRNV
ALTAPYFHDGSARTLEQAINIMAKYQLGRSLSAKDTQLIVQFLRTLTGEHSELKSGDR
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaaatagaaacgctatataacaaaaacctcttattaatgactaagcaagttctt
cgcaggatatatcttgttgcattggtatttttggcaacattggtagccatttggtggcaa
cgcatccaaacgccccaaccaatgagagaagctgtgtttgaacgcatagaaaccgtacaa
gtcgatgaaccgattcaaccaattccactccagatttccttggatcgaggtaaggtggcg
ttgggcgagcaactgtttcacgagccgcgactctcctcagataataaaatttcttgcctc
agttgtcacgctctcaatcgcgggggggcagataacaaggctttttcaattggcgtgaat
ggtaaagtaggtaacattaatgctccaactgtatataattcagcatttaatgcttacttg
aattggaatggtaaatttgccacgttggaagacttcaccacagccgtgattcaaaatcca
acagcaatgggaattgaatggcaagttttgctgccaaagttgcaacgggttccagactat
gtacgggcgtttaaccaaaattatcctgatggtttgacagccacaaatgttgtagatgcg
atcgccacttatttgcgatcgctatacactcccaattcgcgcttcgatcgctacttacgc
ggcgataaatctgcgattaatgctacagaaaaagaaggctatcgactattccaagcttac
ggttgcgttagttgccatcaaggaatgaatgtgggaggcaatttgtttcaaaagtttggc
attatgggcgactattttcgcgatcgcggtaagattacgaaagtagatttagggcgctat
aacgtcactcaaaatgaggcggatatgtttgtctttcgcgtccctagcctccgcaatgtt
gccttaacagcaccctattttcacgatggttccgctcggacgttagaacaagcaattaat
atcatggcaaagtatcaactagggcgatcgctttctgctaaagatacccagttaatcgtt
cagttcctccgcactctcacgggagagcattctgaattaaaatctggcgatcggtaa

DBGET integrated database retrieval system