KEGG   Chroococcidiopsis thermalis: Chro_1143Help
Entry
Chro_1143         CDS       T02360                                 

Definition
glycogen branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
cthe  Chroococcidiopsis thermalis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:cthe00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Chro_1143
Enzymes [BR:cthe01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Chro_1143
Exosome [BR:cthe04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Chro_1143
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1274401..1276695
Genome map
AA seq 764 aa AA seqDB search
MSMTTIAPEQVDRIIWNQHQDPFEVLGAHSVEQEGKTVWAVRAYLPNASAAWVVLPEERK
EFPMETVHHPHFFECTLDLPELANYQLRILEGERERVIYDPYAFRSPRLTDFDLHLFAEG
NHHRIYEKLGAHATEINGVQGVYFAVWAPNARNVSVIGDFNHWDGRKHQMRKGATGVWEI
FIPELKVGDRYKYEIKNNNGHIYEKSDPYGYQQEPRPKTASIVTDLDAYEWSDLAWMEKR
RHTDPLTQPISVYEVHLGSWLHASSAEPPKLPNGETEPVVIVSELKPGARFLTYRELGDR
LIPYVKDLGYTHIELLPIAEHPFDGSWGYQVTGYYACTSRYGTPEDFMYFVDQCHQNGIG
VIVDWVPGHFPKDGHGLAFFDGTHLYEHADPRKGEHKEWGTLVFNYSRNEVRNFLVANAL
FWFDKYHIDGIRVDAVASMLYLNYCRKEGEWLPNQYGGTENLEAAEFLRQTNHVIFSYFP
GIVSIAEESTAWPMVSWPTYMGGLGFNLKWNMGWMHDMLDYFSMDPWFRQFHQNNVTFSM
WYHHSENYMLALSHDEVVHGKSNIIGKMPGDRWQKFANVRCLFTFMFVHPGKKTMFMSME
FGQWSEWNVWGDLEWQLLQYESHQQLKQFFKDLNHTYRSEPALYSQDFAEAGFEWIDCSD
NRHSVVALIRRAKDSEDFAIAVCNFTPQPHSHYRIGVPEPGFYQELFNSDSREYGGSNMG
NLGGKWTDEWQYHNHPYSIDLCLPPLGVLILKLNREKTAEAMSK
NT seq 2295 nt NT seq  +upstreamnt  +downstreamnt
atgtctatgaccaccattgcaccagaacaggtagatcgaattatttggaaccagcatcaa
gatccttttgaagtgctaggcgctcattccgtggaacaggaaggcaaaaccgtctgggca
gtgcgagcatacttaccaaatgcgagtgcggcgtgggtggtactgccagaggaaagaaaa
gaatttccgatggagaccgtgcatcatcctcacttttttgaatgcacgctcgatcttccc
gaactggcaaactatcagttgcggattttggagggagaacgcgagcgtgtgatttacgac
ccctacgcctttcgctctccccgcttgacagattttgacctgcatctatttgcggaaggc
aatcaccaccgcatttatgaaaaactaggagcgcacgcaacagaaattaacggtgtccaa
ggcgtttatttcgctgtttgggctccgaacgcgcgcaacgtgtcagttattggagatttt
aatcattgggacggacgcaagcaccagatgcgcaaaggtgctacaggagtatgggaaata
tttattcccgaactcaaagtcggcgatcgctataaatatgaaataaaaaataacaatggt
cacatctacgaaaagtctgacccttatggctatcagcaagaaccccgacccaaaaccgca
tccattgtcacagacttagacgcttatgaatggagcgatttggcatggatggaaaaacgc
cgccataccgaccccctaacacagccaatttctgtttatgaagtccatctcggttcgtgg
ctgcacgcctcctctgccgaacctcccaagttgcctaatggggagacagaacccgtcgtc
attgtctcggaactcaaaccgggggcgcgttttctcacctatcgagaacttggcgatcgc
ctgattccctacgtaaaagatttaggatacacccatattgaattattaccaattgcagag
catccctttgacggctcttggggatatcaagtcactggctattatgcttgtacgtcccgc
tatggcacgccagaagacttcatgtattttgttgaccaatgccaccaaaacggtattggg
gtaatcgttgattgggttccaggtcattttcctaaagatggacacgggttagcattcttt
gatgggactcacctctacgaacatgccgatccgcgcaagggagaacacaaagaatgggga
actttagtattcaactacagccgcaacgaagtgagaaacttcttggttgccaacgccttg
ttctggtttgataagtatcatatcgacggaattcgggtagatgccgttgcctcaatgctt
tacctgaactattgccgcaaagaaggggaatggttgccaaatcaatatggtggcacggaa
aatttagaggcagcagagttcctgcggcaaacaaatcacgttatttttagttattttcct
ggtatcgtctccatcgcggaagaatctaccgcttggcctatggtatcttggcctacgtat
atgggcggattaggctttaatctcaagtggaacatgggctggatgcacgatatgctggat
tacttcagcatggacccttggtttcgccagttccaccaaaataacgtcactttcagcatg
tggtatcaccacagcgaaaattacatgttggctctatcccacgatgaagtcgtacatggc
aaaagtaacatcatcggtaaaatgccaggggataggtggcagaaattcgccaacgtccgc
tgcttgtttaccttcatgttcgttcaccccggcaaaaaaaccatgtttatgagcatggag
tttggacagtggagcgagtggaacgtctggggtgacttagagtggcagttgttgcaatat
gaatcacaccaacagctcaagcagtttttcaaagatctaaaccacacatatcgctctgaa
ccagctttgtacagccaagattttgctgaagcggggtttgagtggatcgattgcagcgac
aatcgccatagcgtagttgcgttaattcgtcgcgccaaagattcagaggattttgcgatc
gcagtttgtaactttactccccaaccgcactctcactacagaattggcgtacccgaacca
gggttttaccaagagttatttaatagcgattcccgcgagtacggcggtagcaacatgggt
aacttagggggcaaatggacggatgaatggcaataccacaatcatccctattccatcgat
ctgtgtttgcctcccttaggcgtgctgattttgaagctaaatcgggaaaaaacagcagag
gcgatgagtaagtaa

DBGET integrated database retrieval system