KEGG   Chroococcidiopsis thermalis: Chro_1312Help
Entry
Chro_1312         CDS       T02360                                 

Definition
L-threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
cthe  Chroococcidiopsis thermalis
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:cthe00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Chro_1312
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Chro_1312
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Chro_1312
Enzymes [BR:cthe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Chro_1312
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1455159..1456460)
Genome map
AA seq 433 aa AA seqDB search
MTQAIANQTKTNATFRALKCKECGAEYELQAMHVCEYCFGPLEVAYDYSALRDTVTRESI
QKGPHSIWRYRPFLPVATDNPIDVGTGLTPLVRANRLARRLGLKKLYIKNDAVNMPTLSF
KDRVVSVALTRARELGFTTVSCASTGNLANSTAAIAAHAGLDCCVFIPADLEAGKVLGTL
IYSPTVMAVQGNYDQVNRLCSEVANTYGWGFVNINLRPYYSEGSKTLGYEVAEQLGWELP
DHVVAPLASGSLFTKIYKGFQEFTEVGLVEGKHVRFSGAQADGCSPIAQAYRDGKDFIKP
VKPSTIAKSIAIGNPADGVYALDIARKTNGNIESVSDPEIIEGIKLLAETEGIFTETAGG
TTIAVLKKLVEAGKIDPEETTVAYITGNGLKTQEAVQGYAGEPLTIEPKLDSFERALERS
RTLERLDWQQVLV
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgactcaggcgatcgcaaaccaaaccaagacaaacgccacgtttagagccttgaaatgt
aaagaatgtggtgctgagtacgaactacaagcaatgcacgtttgcgaatattgctttgga
ccattggaagttgcctacgattacagcgctctgcgcgataccgtcactcgcgaaagcatt
caaaaaggaccccactcaatttggcgctatcgtccttttttacctgttgctaccgataac
ccaatcgatgtcgggactggcttaacacctttagttcgtgccaatcgcctagcgcgtcgc
ctcggactgaaaaagctttacatcaagaacgatgctgtcaacatgcctaccctgagcttt
aaagatcgggtggtatcggtagccctgactcgtgctagagagctaggctttacgacagta
tcttgtgcgagtacggggaatttagctaattctaccgcggcgatcgccgctcacgcaggt
ttagattgctgcgtctttatccccgccgatttagaagcaggtaaggttttaggaactttg
atctacagccctactgtaatggcagtacaaggtaactacgaccaagtcaaccgcctctgt
tctgaagtagcgaatacatacggctggggttttgtcaatatcaatttgcgcccctattac
tccgaaggttccaagactttaggttacgaagttgcagaacaactgggttgggaactccca
gaccacgtagttgcgcctctagcttctggttccctgttcaccaaaatctacaaaggcttc
caagaatttaccgaagttggcttagtagaaggcaagcacgtcagattcagcggcgcgcaa
gccgacggatgttcgccaattgcccaagcttacagagatggcaaagactttatcaaacca
gtaaaaccgagtacgattgctaaatcaatcgcgatcggtaatcccgctgatggtgtctat
gccttagatattgcgcggaaaacaaatggtaatattgaatcagtcagcgatcctgaaatt
atcgaaggcatcaaattactagcagaaactgaaggtatctttaccgaaaccgcaggtgga
accacgatcgccgtgttgaaaaaactggtagaagcaggtaaaatcgaccccgaagaaact
accgttgcttacatcactggaaatggcttgaagacacaagaagccgtccaaggatatgca
ggcgaacccctaacaattgagccaaaactcgatagctttgaaagagcattagagcgttct
cgcaccctcgaacgcctagattggcaacaagttttggtctaa

DBGET integrated database retrieval system