KEGG   Chroococcidiopsis thermalis: Chro_1409Help
Entry
Chro_1409         CDS       T02360                                 

Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
cthe  Chroococcidiopsis thermalis
Pathway
cthe00330  Arginine and proline metabolism
cthe00332  Carbapenem biosynthesis
cthe01100  Metabolic pathways
cthe01130  Biosynthesis of antibiotics
cthe01230  Biosynthesis of amino acids
Module
cthe_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:cthe00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Chro_1409
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    Chro_1409
Enzymes [BR:cthe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Chro_1409
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: AFY86935
UniProt: K9TWJ4
Position
complement(1571549..1572664)
Genome map
AA seq 371 aa AA seqDB search
MLRTQTIVVKIGTSSLTQSQTGLLALSTIATLAETLSHLRRQGHRVILVSSGAVGIGCAR
LGLTERPRTMAMKQAVAAVGQGRLMRVYDDFFTTLQQPIAQVLLTRSDVGERSRYVNAYN
TFQALLEIGVIPIVNENDTVAVQELKFGDNDTLSALVASLVEADWLFLLTDVDRLYSADP
RSFPDAQPIALVTHMEQLAQLQVQVGSPGSQWGTGGMVTKIAAARIATAAGVRTVITEGR
FPHNIEKIIQGEPLGTQFAPQLQPTNARKRWIAYGLIPTGKLYLDDGAVKAICQQGKSLL
AAGITTIEGEFDSQDAVQICDRFGKEVARGIVNYSSSELQNIRGRHSREIATILGYAGAA
NIIHRDNLVLI
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgttgcgaactcaaaccattgttgtcaaaattggcacttctagtctgacgcaatcgcag
acaggtttactagctctctccacgatcgcgactttagcagaaactctctctcatctccgt
cgtcaggggcatcgggtgattttagtgtcttctggagctgtagggatcggttgcgctcga
ttggggctgacagagcgcccccgcacgatggcaatgaaacaggcagtagcggctgtcgga
cagggacggttgatgcgcgtatacgacgatttttttacaactctgcaacagccaatcgct
caagtgctgctgacccgtagcgatgttggagaacgcagtcgctatgtcaatgcatacaac
acatttcaagccttgttggaaattggcgtgattccaattgtgaatgagaatgacacggta
gcagttcaagaactaaaatttggcgataacgatactctctctgccctagttgccagtttg
gttgaggcagattggctatttttactgacagatgtagaccgtctctattctgccgatccg
cgatcgtttcccgatgctcagccaattgcgttggtaacgcacatggaacaactagcccaa
ttacaagtacaagtaggttctcctggttcccaatggggaacgggtggcatggtgacgaag
attgcagcggcacgaattgctacagcggctggtgtccgtactgtcattactgaagggcga
tttccacataatattgaaaaaattatccagggagagcctttaggaactcagttcgcgcct
caacttcaaccgactaacgctcgtaaacgctggattgcttatggtttaattcctacgggt
aagctttacttagatgacggtgcggttaaggcaatttgccagcagggaaaatctttacta
gcggctggcattactaccattgaaggcgaatttgacagtcaagatgccgttcaaatttgc
gatcgctttggcaaagaagttgctagaggtattgtcaactatagcagtagcgaactgcaa
aacattcgcgggcgacactcgagagaaattgccacaattttaggctatgctggtgcagca
aacataattcaccgcgataatctagttttgatttaa

DBGET integrated database retrieval system