KEGG   Chroococcidiopsis thermalis: Chro_1580Help
Entry
Chro_1580         CDS       T02360                                 

Definition
protoporphyrin IX magnesium-chelatase (EC:6.6.1.1)
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
cthe  Chroococcidiopsis thermalis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:cthe00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1749914..1752169
Genome map
AA seq 751 aa AA seqDB search
MPASSTATVTSFPLTAVVGQEAIKIALLLAAVDPGLGGVAIAGRRGTAKSVMARAIHTLL
PPIEVVKGSFCNCDPNRPEEWDDELSRDVTCNVSTEGNVSTEGNVPTEVIPAPFIQIPLG
VTEDRLLGSVDVEQSVKQGETVFQPGLLALAHRGVLYVDEINLLDDSISNQLLTVLTEGR
NQIEREGISFGHPCQPLFIATYNPEEGALREHLLDRIAIALSADGVLGLDERVQAVEQAI
AYTTSPQQFLQQYAEDLDNLKTQIILAREWLKDVQITHEQIAYLVDEAVRARVQGHRAEL
YAVRVAKAAAALEGRTTVTAEDLRRAVELVIVPRATVVQTPPEAPPPPPPPPQNQDEPED
ESNQEQEEQEEKDEQEEPENEQTPPNIPEEFVFDAEGVILDDSVLYFAQMAQRRGKSGSR
SLIFSEDRGRYVKPMLPKGPVRRIAVDATLRAAAPYQKARRERQGAGSLGVQGVETRETR
ETRETRETRETRETRETRETRETRETRETRETRETREQLPTTNYPLPITNYPQKRVFVEQ
GDIRSKRLVRKAGALIVFVVDASGSMALNRMQSAKGAVFQLLTEAYENRDQVALIPFRGE
QAEVLLPPTRSIALARKRLELLPCGGGSPLAHGLTQAVRVGMNAQMAGDIGQVVVVAITD
GRGNIPLARSLGEPLPEGEKPDIKKELLEIAARIRGLGIQLLVIDTENKFISTGFAKELA
QTAGGKYYHLPKATDSAIAGVAKSAINAIRG
NT seq 2256 nt NT seq  +upstreamnt  +downstreamnt
atgcctgcgtcgtctactgcaaccgttaccagttttcccttaactgctgtcgtgggacaa
gaagccattaaaatagccctgctgctagcagccgtcgatcctggtttgggaggagtcgcg
atcgcaggtcgtcgcggtacggcaaaatcagtcatggcgcgggcaattcataccctttta
ccgccgattgaagttgttaaaggttctttttgtaactgcgatcccaatcgccctgaagaa
tgggacgacgaactaagtagagacgttacatgtaacgtctctacagagggtaacgtctct
acagagggtaacgtccctacagaagtgattcccgcaccattcatacaaattcctttaggc
gtgacagaagaccgacttttaggttcggtggatgtagaacaatcggtcaaacagggagaa
accgtatttcaaccaggactgctggcacttgcccatcgtggcgtgttgtatgtcgatgaa
attaacttactcgacgacagtattagcaaccaactgctgacggttttaaccgagggacgc
aaccaaatcgaacgggaaggaattagttttgggcatccctgtcagcctttatttatcgct
acgtataacccagaagaaggagcgttacgggaacacctgctcgatcgcatcgcgatcgct
ctttctgcggatggcgtgctaggtctagacgaacgagtacaagcagtagaacaggcgatc
gcttacaccacctcaccgcagcagtttctccagcaatacgccgaagatctcgacaatctc
aaaactcaaattatcttggcgcgagagtggctcaaagacgtacaaattacccacgagcaa
attgcctatttagtcgatgaagcggtacgcgctagagtccagggacaccgcgccgaactc
tacgccgtgcgagtcgccaaagccgccgccgctttagaaggcagaaccacagttacagcc
gaagatcttcgtcgcgccgtagaattagtcatcgtcccgagagcaacagtcgtacaaact
ccacccgaagcaccacccccaccacctccaccaccccaaaaccaagacgaacccgaagat
gagtctaaccaggaacaggaggagcaggaagagaaggacgaacaggaagaacctgaaaac
gagcaaacaccgcccaacattcctgaagaatttgtctttgatgccgaaggtgtaattctc
gacgacagcgtgctttatttcgcacagatggcacagcggcgggggaagtccggcagtcgc
agtttaattttctccgaagatcggggacgatacgtcaaaccgatgttacccaaaggtccc
gtgcgacgaattgcagtagatgccacgttaagagcagctgcaccttatcagaaggcacgg
cgggagaggcagggagcagggagcctgggagtgcagggagtagagacaagggagacaagg
gagacaagggagacaagggagacaagggagacaagggagacaagggagacaagggagaca
agggagacaagggagacaagggagacaagggagacaagggagacaagggagcaactacca
actaccaattacccattaccaattaccaattacccacaaaaaagagtttttgtcgagcag
ggagatatccgctcgaagcgactcgtccgcaaagcgggagcattgatcgtgtttgtggtt
gatgcttctggctcgatggcgttgaatcggatgcaatcagctaagggggcagtttttcag
ctcttgacagaagcgtatgaaaatcgcgaccaagtggcgttgatcccgtttcgtggcgaa
caggcagaggtgttgttgcctcctacccgttcgatcgctttggcgcgtaaacgattggag
ttgttgccttgtggtggcggttcgcccctagcgcatggtttaacacaagcggtacgggtg
ggtatgaatgctcaaatggcgggagatatcggacaagtggtcgttgtggcaattaccgac
ggtcgaggaaatatacctttggcgcgatcgctaggcgaacctttaccagagggagaaaag
cccgatatcaagaaagaactactggaaatcgccgctagaattcgcggattgggaatacag
ctgttagtcatcgatactgaaaataaatttatctctacaggttttgctaaagaactagct
caaactgcgggaggaaaatactaccacctaccaaaagctactgactccgcgatcgctggt
gttgctaaaagtgcaattaatgcgattaggggttag

DBGET integrated database retrieval system